(data stored in ACNUC7421 zone)

EMBL: CP002047.PE367

CP002047.PE367       Location/Qualifiers
FT   CDS_pept        429638..430759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00367"
FT                   /product="putative ring hydroxylating dioxygenase subunit"
FT                   /note="COG4638 Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03488"
FT                   /db_xref="GOA:D7BYG0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG0"
FT                   /protein_id="ADI03488.1"
FT                   /translation="MTATSLPPSLIRTLSGEHYTDPAIFALEQERVFEAMWFCVARSAD
FT                   LAEPGQFRTYQVGRESVLISRSRDGSVKGFLNICRHRGAKLCLEASGEVKRAFQCPYHA
FT                   WTYGLDGKLVAAPNLTSMPDIDRGEYGLVNVHIREWLGYVWASLADAPPSFEQDVIGAV
FT                   IERLGDVAAIDNYRIENLEVGRRITYDVKANWKLIVENFMECYHCATIHPELTEVLPEF
FT                   ADGYAAQYYVGHGAEFGADVQGFTVDGGEGLDRIPGVGEDQDRRYYAITVRPQVFINLV
FT                   PDHVIFHRMYPMAPDRTVVECDWLYLPHVVESGQDVTRSVELFHRVNQQDFDACERTQP
FT                   AMSSRAYAKGGVLVPSEHHIGAFHTWLQNKLSA"
     gtgaccgcga ccagtctgcc ccccagcttg atccgcacgt tgtcggggga gcactacacc        60
     gatcccgcga tcttcgcgct cgagcaggag cgtgtcttcg aggccatgtg gttctgtgtg       120
     gcccgctcgg ccgatctggc cgagccgggt cagttccgta cgtatcaggt cgggcgggag       180
     agcgtgttga tctcccgttc gcgggacggt tcggtcaagg gcttcttgaa catctgccgc       240
     caccggggcg cgaagctgtg cctggaggcg tcgggtgagg tcaagcgggc cttccagtgc       300
     ccataccacg cctggaccta cggtctggac ggaaagctcg tcgcggcccc gaatctgacg       360
     tcgatgccgg atatcgaccg gggggagtac ggcctggtca atgtgcatat ccgggagtgg       420
     ctgggctatg tgtgggcgtc actggccgac gctcccccgt cgttcgagca ggacgtgatc       480
     ggcgcggtga tcgagcgtct gggcgatgtg gcggcgatcg acaactaccg catcgagaac       540
     cttgaggtgg gtcggcggat cacctatgac gtcaaggcca actggaagct catcgtcgag       600
     aacttcatgg agtgctacca ctgcgccacc atccaccccg aactgacgga ggtgctgcct       660
     gagttcgccg atgggtacgc ggctcagtac tacgtcggtc acggcgcgga gttcggcgcg       720
     gatgtccagg ggttcaccgt cgacggcggt gagggccttg accggatccc cggcgtcggg       780
     gaggaccagg accggcgtta ctacgcgatc accgtcagac cgcaggtctt catcaacctg       840
     gtgccggacc atgtgatctt ccaccggatg tatccgatgg cacccgaccg gacggtcgtg       900
     gagtgcgact ggctgtatct gccgcatgtg gtggagagcg gtcaggacgt gacccgttcg       960
     gtcgagctgt tccaccgggt caaccagcag gacttcgacg cctgcgagcg cacccagccc      1020
     gcgatgagct cacgggccta tgccaagggc ggcgtgctgg tgcccagcga acaccacatc      1080
     ggcgcattcc acacctggct gcagaacaag ctgagcgcct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page