(data stored in ACNUC7421 zone)

EMBL: CP002047.PE369

CP002047.PE369       Location/Qualifiers
FT   CDS_pept        431772..434210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00369"
FT                   /product="putative dehydrogenase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03490"
FT                   /db_xref="GOA:D7BYG2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG2"
FT                   /protein_id="ADI03490.1"
FT                   /translation="MAGPRVVIIGAGVVGAALADELSTRGWTDITVVDQGPLPATGGST
FT                   SHAPGLVFQTNSSKTMTELARYTVEKFCSLEVAGQPCFLQVGGLEIATTPERLAELRRR
FT                   HGWVTSWGVEARLIGPDECVELHPLVDRERVLGGLLVPTDGLAKAVLAVEAQLTAARER
FT                   GVRTLGRHEVLDIREEDGRVSAVVTDHGEIPADIVVCCAGIWGPKVARMVGMNLPLTPL
FT                   AHQLAWTGPVPALAGQAEEAVRPILRHQDADLYYRDRFDQLGIGYYGHRTMPVSPDDIA
FT                   SVDSAEHMPSVLRFTKDDFTDAWSETQALLPATKDAKIEEGINGLFSFTTDGLPLLGES
FT                   PDVKGFWVAEAVWVTHSAGVGRAVAEWLVDGHCTSFDLHECDVNRFEPHQLAPEYVLAR
FT                   DCRNFVEVYDILHPLQPTGAPRPLRTSPFHPRQQELGGYFLEASGWERPQWYATNEALL
FT                   KGRNIPTPNDWAARYWSPIVGAEAQATRESVALYDMTALKRLEVTGRGAAGLLQRMTTA
FT                   NVDKSVGSVTYTLMLDHNGGIRSDITVARLGRGHFQVGAGGNLDLDWLTRHLPEDGSVT
FT                   VRDITGGTCCIGLWGPKARDMLQPLADQDFSNAGLRYFRARKAHIGPVPVTAMRLSYVG
FT                   ELGWELYTTADMGLKLWDTLWEAARPHGGIAAGRGAFNSLRLEKGYRSFGTDMTYEHDP
FT                   YEAGVGFAVKMDKGDFIGRAALERRAADVRRRLVCLTIDDPHAVVMGKEPVYDGARPVG
FT                   YVTSAAYGYTIGKGIAYAWLPADLATAGRSLTIGYFDQRVPAAVAEEPLFDPNMQRLRG
FT                   "
     atggcgggac cgcgcgtggt catcatcgga gcgggcgtcg taggggccgc tctggccgac        60
     gagctctcca cccggggctg gacggacatc acggtcgtgg accagggccc gctgcccgcc       120
     accggcggat ccacgtccca cgccccgggc ctggtgttcc agaccaattc ctcgaagacc       180
     atgaccgaac tggcccgtta caccgtggag aagttctgct ccctcgaagt tgccgggcag       240
     ccctgtttcc tccaggtcgg cggcctcgaa atcgccacca cccccgagcg gctggccgag       300
     ctgcgccgcc ggcacggctg ggtgacctcc tggggcgtcg aggcccggct gatcggcccg       360
     gacgagtgcg tcgagctgca tccgctggtc gaccgcgagc gtgtgctcgg cggactgctc       420
     gtccccacgg acggcctggc caaggccgta ctcgcggttg aggcacagct gacggccgcc       480
     cgggagcgcg gcgtacgaac cctcggccgt cacgaagtcc tcgacatccg cgaggaggac       540
     ggccgcgtca gcgccgtggt caccgaccat ggcgagatcc ccgcggacat cgtcgtctgc       600
     tgcgccggca tctggggccc caaggtcgcc cgcatggtcg ggatgaacct tcccctgaca       660
     ccgctggccc accaactcgc ctggaccggc cccgttcccg ccctcgccgg gcaggccgag       720
     gaagccgtcc gcccgatcct ccgccaccag gacgccgacc tctactaccg cgaccgcttc       780
     gatcagctcg gcatcggcta ctacggccac cgcacgatgc cggtgtcgcc cgacgacatc       840
     gcctccgtcg actccgccga gcacatgccg tctgtgctcc gcttcaccaa ggacgacttc       900
     accgacgcct ggagcgagac ccaggccctc ctgcccgcca ccaaggacgc caagatcgaa       960
     gagggcatca acggcctctt ctccttcacc accgacgggc ttccgctgct cggtgagtcg      1020
     cccgacgtca agggcttctg ggtcgccgag gccgtatggg tcacccactc cgccggcgtc      1080
     ggccgcgccg tggccgaatg gctggtcgac ggccactgca catccttcga cctgcacgaa      1140
     tgcgatgtca accgcttcga accgcatcag ctcgcccccg agtacgtact cgcgcgagac      1200
     tgccggaact tcgtcgaggt ctacgacatc ctgcaccccc tgcagcccac cggcgcgccc      1260
     cggcccctgc gcaccagccc gttccacccc cgccagcaag aactcggcgg ctacttcctg      1320
     gaagcctccg gctgggagcg gccccagtgg tacgccacga acgaggccct gctgaagggg      1380
     cggaacatcc ccacgccgaa cgactgggcc gcccgctact ggtcgcccat cgtcggcgcc      1440
     gaggcccagg cgacgcgcga gtccgtcgcc ctgtacgaca tgacggcgct caagcggctc      1500
     gaggtcaccg gccgcggggc cgccggcctc ctccagcgga tgaccaccgc caacgtcgac      1560
     aagtccgtcg gctcggtcac gtacaccctg atgctcgacc acaacggcgg catccgcagc      1620
     gacatcaccg tcgcccgcct gggccgcggc cacttccagg tcggcgcagg cggcaacctg      1680
     gacctggact ggctcacccg ccacctgccc gaggacggat ccgtcaccgt ccgcgacatc      1740
     accggcggca cctgctgcat cggactgtgg ggcccaaagg cccgcgatat gctccagccg      1800
     ctggccgacc aggacttctc caacgcgggg ctgcgctact tccgcgcccg gaaggcccac      1860
     atcggccccg tccccgtcac ggcaatgcgg ctgtcctacg tcggggagct gggctgggag      1920
     ctctacacca ccgcggatat gggcctgaag ctctgggaca ccctgtggga ggcggcccgg      1980
     ccgcacggcg ggatcgcggc cgggcggggc gcgttcaaca gcctgcgcct ggagaagggc      2040
     taccggtcct tcgggaccga tatgacctac gagcacgacc cctacgaggc cggcgtcggc      2100
     ttcgccgtca agatggacaa gggcgacttc atcggccgtg ccgcactgga gcggcgggcc      2160
     gccgacgtcc ggcgccggct ggtctgcctc accatcgacg acccgcacgc cgtggtcatg      2220
     ggcaaggagc ccgtctacga cggggcccgc ccggtcggct atgtcaccag cgccgcctac      2280
     ggctacacga tcggcaaggg gatcgcgtac gcatggctgc ccgccgacct ggccaccgcg      2340
     ggacgctccc tgaccatcgg ctacttcgac cagcgcgtcc ccgcggccgt cgccgaggag      2400
     cccctgttcg acccgaacat gcagcgcctg cgcggctga                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page