(data stored in ACNUC7421 zone)

EMBL: CP002047.PE37

CP002047.PE37        Location/Qualifiers
FT   CDS_pept        complement(35444..35611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00037"
FT                   /product="putative IstB-like ATPase"
FT                   /note="COG1484 DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03158"
FT                   /db_xref="GOA:D7BSY1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY1"
FT                   /protein_id="ADI03158.1"
FT                   /translation="MFLAQRRRRIQAVGDSGTGKSHMLIVLGTEAAMKGYRVSHTPSFI
FT                   KSSCVVPPAR"
     gtgttccttg cgcagcggcg acggcgtatc caggccgtcg gcgactccgg caccggcaag        60
     tcccacatgc tcatcgtgct gggcaccgag gctgcgatga agggctaccg cgtcagccac       120
     acgccgtcct tcatcaagtc gagctgcgtg gtgccgccgg cgagataa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page