(data stored in ACNUC7421 zone)

EMBL: CP002047.PE371

CP002047.PE371       Location/Qualifiers
FT   CDS_pept        435474..437144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00371"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.38"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03492"
FT                   /db_xref="GOA:D7BYG4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG4"
FT                   /protein_id="ADI03492.1"
FT                   /translation="MTETRRRTPATPAALADPPRNHGVAFTQEERDALGLTGRLPSGVL
FT                   TLDQQAQRAYQQMNAQGGDLAKNVYLEQLHDRNETLYFKVLSDHLAELLPIVYDPTVGE
FT                   AIEKYSNEYRRPRGIFLSIDRPEDMERAFATLELGPEDVDLIVCSDAEQILGIGDWGVG
FT                   GIQIAVGKLAVYTAAAGVDPRRVVPVSLDVGTDRKSLLDDPLYLGNRHPRVRGADYDAF
FT                   MEKYLETASSLFPHALLHFEDFGPSNARRILEQYGRRYRIFNDDMQGTGAITLAAALSA
FT                   VKVSGVRMRDQRLVVFGAGTAGVGIADQLRDAMVRDGADRGQATGQVWLIDKQGLLIRG
FT                   MADLRDFQQPYARDPAEVADWARDDGAISLLETVRRVKPTILLGTSTVHGAFTREVVQA
FT                   MSEGTERPIVLPLSNPTSRIEAMPADVIAWSKGKALVATGIPVAPVEYGGVTYRIGQAN
FT                   NALLYPGLGLGTIVSGASQVTAGMLLAAAQAVADQVDASGPGASLLPPVENLRESSAIT
FT                   ATAVVKAALDEGVATCKPADVADAVREAMWQPAYTAGAT"
     atgaccgaga cccgtcggcg gaccccggcc acccccgccg ctctggccga tccgccacgt        60
     aaccacggcg tcgccttcac ccaggaggag cgggacgccc tcggcctcac cggacggctg       120
     ccgtccgggg tcctcaccct cgaccagcag gctcagcgcg cctatcagca gatgaatgcg       180
     cagggtggcg acctggccaa gaatgtttat ctggagcagt tgcacgaccg caacgagacc       240
     ctgtacttca aggttctctc cgatcatctg gcggaactgc tgcccatcgt ctacgacccc       300
     accgtgggcg aggcgatcga gaagtactcc aacgaatacc gccgccctcg aggcatcttc       360
     ctgtccattg atcgaccgga ggacatggag cgggccttcg ccacgcttga actcgggccc       420
     gaggacgtcg atctgatcgt gtgctccgac gcggagcaga tcctgggcat cggcgactgg       480
     ggcgtcggag gtatccagat cgcggtcggc aagctggcgg tgtacacggc ggctgccggt       540
     gtggatccgc gccgggtcgt gcccgtatcg ctggacgtgg gtacggaccg aaagtcactg       600
     ctggacgacc cgctgtatct gggcaaccgg cacccccgcg tccgcggcgc cgactacgac       660
     gcgttcatgg agaagtacct ggagaccgcg tcgtccttgt tcccccacgc cttgctgcac       720
     ttcgaggact tcggccccag caacgcgcga cggatcctgg agcagtacgg ccggcgctac       780
     cggatcttca acgacgatat gcaggggacg ggcgcgatca cgctcgccgc cgcgctgtcg       840
     gccgtcaagg tgagcggtgt gcggatgcgg gaccagaggc tggtcgtctt cggggccggc       900
     accgcggggg tgggcatcgc cgatcagctg cgcgacgcga tggtccgcga cggcgcggat       960
     cgggggcagg ccaccggaca ggtgtggctg atcgacaagc aggggctgct catccggggc      1020
     atggccgatc tacgtgactt ccagcagccc tacgcacgcg atcccgccga ggtcgcggac      1080
     tgggcgaggg acgacggcgc gatctcgctg ctggagaccg tgcgccgggt caaacccacc      1140
     atcctgctgg gcacttccac cgtgcacgga gcgttcaccc gcgaggtcgt ccaggccatg      1200
     tccgagggca cggagcggcc gatcgtcctc ccgctgtcca atcccacctc acggatcgag      1260
     gccatgcccg ccgatgtcat cgcctggtcc aagggaaagg cgctggtcgc caccggtatc      1320
     cccgttgcgc ccgtggagta cggcggtgtg acctaccgga tcgggcaggc gaacaacgcc      1380
     ctgctgtacc cgggtcttgg cctgggcacg atcgtctccg gagcgtccca ggtgaccgcg      1440
     ggcatgttgc tcgcggcggc ccaggcggtc gcggaccagg tcgatgcgag cgggccgggc      1500
     gcctctctgc tgccgcccgt cgaaaacctc cgcgagtcct cggcgatcac cgcgaccgcc      1560
     gtggtcaagg ctgcgctcga cgagggagtg gccacctgca agccggccga tgtcgcggac      1620
     gccgtccggg aggccatgtg gcagcccgcg tacaccgccg gagcgacgtg a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page