(data stored in ACNUC7421 zone)

EMBL: CP002047.PE373

CP002047.PE373       Location/Qualifiers
FT   CDS_pept        438061..439014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03494"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG6"
FT                   /protein_id="ADI03494.1"
FT                   /translation="MSTSIRVWPRLVYEELAPMVAFVNRLVQVAGKYTLDEPFEVGWGN
FT                   IVLDVTPRGLRTPTLRKRDVTFTVHYRLLDGDVVIEADSGTRTVPLFDESLAAFYASFC
FT                   HAVGDLGIRRPGSSLICEIPDAPATFGDDRVERHWDDRTAGLIWSALNLAAGGLEAWQA
FT                   PFQGHRPRVGVMWGGFDLSATRHRARPTAPPAQVPAFQQNAQIEEYMAVGFAFGTPDAP
FT                   DPGMYAYIWPQPDGLEGRSWGVDGAAWNPDAGLVLLPWATLRDTPNPHQSIVAFGDAVY
FT                   DAAVETAGWPSDLVGPRCDGWYMSRTPPSLAEARHH"
     gtgagcacat ccatccgcgt atggccacgg ctggtctacg aggaactggc tcccatggtt        60
     gccttcgtga accgattggt gcaggtcgcg ggcaaataca ccctcgacga gccgttcgaa       120
     gtcggctggg gaaacatcgt cctcgatgtc acaccccgtg ggctcaggac accaacgctc       180
     cggaagcgag atgtgacctt caccgtgcat taccgtctgc tcgacggcga cgtggtcatc       240
     gaggcggact cgggcacacg gaccgtgccg ttgttcgacg aatcgctggc cgcgttctac       300
     gcgtcgttct gccatgcggt gggcgacctc ggcattcgcc gcccgggctc ctcgttgatc       360
     tgcgagattc ccgatgcccc ggcgaccttc ggagacgatc gcgtcgaacg ccactgggat       420
     gaccgcaccg ctgggctgat ctggagcgcg ctgaacctcg ccgccggcgg tctcgaggcg       480
     tggcaggcgc ccttccaagg ccaccgcccc cgggtcggtg tgatgtgggg cggtttcgac       540
     ctctccgcca cgcgccaccg cgcacggccc accgcgccac cggcccaagt cccggcgttt       600
     cagcagaacg cccagatcga ggagtacatg gcagtgggat tcgcgttcgg cacccccgat       660
     gcgccggatc caggcatgta cgcctacatc tggccccagc cggacggcct cgagggccgg       720
     tcctgggggg tcgacggcgc ggcctggaat cccgacgccg gtctggttct gctgccgtgg       780
     gccacgctca gggacacacc caacccgcac cagtccatcg tcgcattcgg tgacgccgtc       840
     tacgacgccg ccgtggagac agcgggctgg ccatcggacc tcgtcgggcc ccgctgcgac       900
     ggttggtaca tgagcaggac accaccttcc ctggccgagg cccggcacca ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page