(data stored in ACNUC7421 zone)

EMBL: CP002047.PE374

CP002047.PE374       Location/Qualifiers
FT   CDS_pept        complement(439031..440659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00374"
FT                   /product="hypothetical protein"
FT                   /note="COG2152 Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03495"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG7"
FT                   /protein_id="ADI03495.1"
FT                   /translation="MTDETTGVSRRGLLLHGAGAVTGSALLGTLAGPPSPAEAAPRQGP
FT                   REEVVLRDDFSPIGGWERQGVILSRSLPWESSLMQDPCLVYGEGGGPLFKMWYGSLHAV
FT                   GYATSDDGSHWTKAADPVLTPTLPSESNALNQPSVVHQGGRWHMTYFGVAGDGNGQIHY
FT                   ATASDPAGPWEKHGVVLTSTMPWEDRWIYNSSLMYDETARLWKMWYTAGKIASAGGEPE
FT                   YICYATAEHPAGPWTKYPGNPVIRPMGDGGWASLGVGGPNVRRLRNGDYETRIVGWQAD
FT                   YPSRGGRLISRDGIGWRLDRAAMDLDLGVAGGPEDRMIYRQFVVEHEGREYLYYNTKNH
FT                   LPEWTETINLAVWNDHVPIVDPAKWCMTQDWQVPGGASFEVRDGCAVSLGNAPDGHCQT
FT                   LQGNARINSLDYTVSASVTPISERVADRDNVLLARHTDRDSYYYAGIASWGNKYAIGVM
FT                   ADGVNTKLASVGTASDIGTGTTHQLRFTLNGSQLDLYDDDRLVLSVVDPTLIPAAGFVG
FT                   LQTSTNTGRAKFGNVSVTARSGRRP"
     atgaccgatg agaccactgg ggtcagcagg cgtggccttc tcctccacgg cgccggagcc        60
     gtcaccggga gcgcgctgct gggaacgctg gccgggcccc cttccccggc ggaggcggcc       120
     ccgcgccagg gcccccggga ggaggtcgtg ctgcgcgacg acttctcacc gatcggcggc       180
     tgggaacggc agggtgtgat cctgagccgg tcactgccct gggagagctc cctgatgcag       240
     gacccctgcc tggtgtacgg cgagggcggc gggccgctgt tcaagatgtg gtacggatcg       300
     ctgcatgccg tgggctatgc gaccagcgac gacggcagcc actggaccaa ggccgccgac       360
     cccgtgctga cgcccaccct gccgtccgag agcaacgcgc tcaaccagcc cagcgtcgtc       420
     catcagggcg ggcggtggca tatgacctac ttcggggtgg cgggcgacgg caacggccag       480
     atccactacg cgacggcgag cgacccggcg ggcccctggg agaagcacgg cgtcgtactg       540
     acctcgacca tgccctggga agaccgctgg atctacaact cctcgctcat gtacgacgaa       600
     accgcacgct tatggaagat gtggtacacc gcaggcaaga tcgcctctgc cggaggcgaa       660
     cccgagtaca tctgctacgc caccgcggag catccggcgg gtccctggac gaagtacccg       720
     ggcaaccccg tcatccggcc catgggcgac ggcggatggg cgtcgttggg ggtgggcggc       780
     cccaatgtcc gcagattgcg caacggcgac tatgagacgc ggatcgtcgg ctggcaggcg       840
     gactacccgt cccggggcgg ccggctcatc tcccgcgacg gcatcggctg gcggctcgac       900
     cgtgccgcca tggacctcga cctcggtgtc gcgggcggcc ccgaggacag gatgatctat       960
     cgccagttcg tcgtggagca cgaggggagg gagtacctct actacaacac caagaaccat      1020
     ctccccgagt ggaccgagac catcaatctc gccgtctgga acgatcatgt gccgatcgtc      1080
     gacccggcca aatggtgcat gacccaggac tggcaggtgc caggcggggc gtcgttcgag      1140
     gtgcgcgacg ggtgcgcggt gtccctgggc aacgctccgg acgggcactg ccagacactt      1200
     caggggaacg cgcggatcaa ctccctggac tacacggtgt cggcgtcggt cacaccgatc      1260
     agcgaacggg tcgccgaccg tgacaacgtc cttctcgcac gccacaccga ccgcgacagc      1320
     tactactacg cgggcatcgc gtcatggggc aacaagtacg cgatcggcgt gatggccgac      1380
     ggggtgaaca ccaaactcgc gagcgtgggc accgcctccg acatcgggac cggcacgaca      1440
     caccagctga gattcacgct caacggctca cagctggatc tctacgacga cgaccggctc      1500
     gtcctgtccg tcgtcgaccc caccctgata ccggcggccg gcttcgtcgg cctccaaacc      1560
     tcgacgaaca ccggcagggc gaagttcggc aatgtgtccg tcacggcccg ctccggccgt      1620
     cggccgtag                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page