(data stored in ACNUC7421 zone)

EMBL: CP002047.PE377

CP002047.PE377       Location/Qualifiers
FT   CDS_pept        444681..444908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00377"
FT                   /product="hypothetical protein"
FT                   /note="COG1141 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03498"
FT                   /db_xref="GOA:D7BYH0"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH0"
FT                   /protein_id="ADI03498.1"
FT                   /translation="MRLVVDLNRCQGFAQCVFLAPDVFALNGEEALLFSPQFDEAQREL
FT                   VERAAAACPVQAILVDYSDEPTKGVEPRVG"
     atgagacttg tcgtcgacct caatcggtgc cagggattcg cgcagtgcgt atttctcgcc        60
     ccggacgtgt tcgccctgaa cggcgaagag gcgctgctgt tctcgccgca gttcgacgag       120
     gcgcagcgcg agctggtgga acgggccgcg gcggcctgcc cggtgcaggc catcctcgtc       180
     gactactccg acgagccgac gaagggggtg gagccccgtg tcggctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page