(data stored in ACNUC7421 zone)

EMBL: CP002047.PE380

CP002047.PE380       Location/Qualifiers
FT   CDS_pept        447694..449703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00380"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03501"
FT                   /db_xref="GOA:D7BYH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH3"
FT                   /protein_id="ADI03501.1"
FT                   /translation="MIDGRFELLARLGGGGMGLVWRAHDLALHREVALKEVRPPDPGLA
FT                   EYDPEAARALRARVLREARALARIVHSNVVTIHHIVDGDEHTYPWLVMELVAGGSLQAR
FT                   LDRGLLSPAEAARLGRGMLAGLAAAHAAGIQHRDIKPANILLRPDGSPVLTDFGIAAVQ
FT                   GSTALTAAGSFIGTPDYMAPERVSGEDGGPEADLWSLAMTLYVAVEGRNPMRRGNALAT
FT                   LAAVLGEDVPPPEHAGALTAVLMSVLVRDPQERPDARTLDRLLTEAEAAAESTTAAGQA
FT                   PGAESTMAAGQAPGAESAPMTGSAPTAGSAAAKAPVDDPSSYPLAPPHPAAPQPSRPVP
FT                   QQGEPPAYVAPPSPPMPQTPPMHPPAPPPAARSRRGWVYGSALGAVAVAGALLWALLPL
FT                   GNGSDGDNTARKPDTSGSPDKASNDTPSSGASNGPSGGKKITIGIKFDQPGLGFKTPAG
FT                   RYSGFDVDVATYIAKALGHNPADIEWKETLSSDREAVLERGEVDFIVAAYAVTDAREKK
FT                   VDFAGPYLEAHQDVLIRGDDTSVRTAQDLNGRRVCAPTGSVSALNVRTKFAPQAQVSER
FT                   ATYALCLSDLKDGAVDAVTADDAILAGYAAREPDSFELGGLAMTDERYGIGVAKGSPLK
FT                   DKIQRALDKMTADGSWTRALKQNLPLLKTDAPPQ"
     gtgatcgacg gccgtttcga gttgcttgcg cggctcggcg gtggcggcat gggactggtg        60
     tggagggcgc atgacctggc gctgcaccgt gaagtcgcgc tcaaggaggt ccgcccgccc       120
     gacccgggac tcgccgagta cgaccccgag gccgcccgcg ccctgcgcgc ccgtgtcctg       180
     cgggaggcca gggcgctcgc gcgtatcgtc cactccaacg tggtgaccat ccatcacatc       240
     gtggacggcg acgaacacac gtacccgtgg cttgtcatgg aactggtcgc cggtggttcg       300
     ctccaggccc gcctcgaccg cggtctcctc tcccccgccg aagcggcccg gctcgggcgg       360
     gggatgctgg ccggactggc ggcggcacac gccgcgggca tccagcaccg ggacatcaag       420
     cccgcgaaca tcctgctgcg gcccgacggc agcccggtcc tcaccgactt cgggatcgcg       480
     gccgtccaag ggtccaccgc cctgacggcc gcgggctcct tcatcggcac acccgactac       540
     atggcgcccg agcgcgtgtc cggcgaggac ggcgggccgg aggccgatct gtggtcgctg       600
     gccatgacgc tctacgtcgc cgtcgagggg cgcaacccga tgcgccgcgg caacgcgctc       660
     gccacgctcg cggccgtcct cggtgaggac gtgccgccgc cggagcatgc cggagcgctg       720
     accgccgtac tgatgtccgt cctggtgcgc gacccgcagg agcgaccgga cgcccgtacg       780
     ctggaccggt tgctgaccga ggcggaggcg gcggccgaat ccacgacggc ggccgggcaa       840
     gcgccagggg ccgaatccac gatggcggcc gggcaggcgc caggggccga gtccgcgccg       900
     atgaccgggt cggcgccgac ggccgggtcc gcggcggcca aggctcccgt cgacgacccc       960
     agctcctacc cgctcgcccc gccccacccg gccgcaccgc agccgtcgcg gcccgtgccg      1020
     cagcagggcg agccgcccgc gtatgtggcc ccgccgtccc cgccgatgcc gcagacaccc      1080
     ccgatgcacc cgccggcgcc gccgccggcg gcccggtcac ggcgcggctg ggtgtacggg      1140
     tcggccctcg gtgccgtggc ggtcgccggc gccctcctgt gggcgctgct gcccctgggc      1200
     aacggctccg acggcgacaa caccgcccgg aagcccgaca cttccggctc ccccgacaag      1260
     gcgtcgaacg acaccccgag cagcggtgcg agcaacggac cgagcggcgg caagaagatc      1320
     accatcggca tcaaattcga ccagcccggc ctcggcttca aaacgccggc tggccgctac      1380
     tcgggcttcg acgtggacgt ggccacgtac atcgccaagg cgctcggcca caatcccgcc      1440
     gacatcgagt ggaaggaaac cctcagcagc gatcgcgagg ccgtgctgga gcgcggagag      1500
     gtcgacttca tcgtcgccgc gtacgccgtc accgacgcgc gggagaagaa agtcgacttc      1560
     gcgggcccgt acctggaggc ccaccaggac gtcctgattc gcggggacga cacctcggtc      1620
     cgtacggccc aggacctcaa cggccggagg gtctgcgcgc ccacagggtc cgtctctgcg      1680
     ctcaacgtcc ggacgaagtt cgcaccgcag gcgcaggtca gcgaacgtgc cacgtacgcg      1740
     ctctgcctct ccgacctgaa ggacggagcc gtggatgccg tcaccgccga cgacgccatt      1800
     ctcgccggct acgccgcccg ggaaccggac agcttcgaac tgggcggcct cgcgatgacc      1860
     gacgagcgct acggcatcgg tgtcgccaag ggcagccccc tcaaggacaa gatccagcgg      1920
     gcgctggaca agatgacggc ggacgggtcc tggaccaggg cgctgaagca gaacctcccc      1980
     ctcctgaaga cggacgcgcc gccccagtga                                       2010
//

If you have problems or comments...

PBIL Back to PBIL home page