(data stored in ACNUC7421 zone)

EMBL: CP002047.PE383

CP002047.PE383       Location/Qualifiers
FT   CDS_pept        450892..451863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00383"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03504"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH6"
FT                   /protein_id="ADI03504.1"
FT                   /translation="MSDERLILSSVAPGGPVHGLAVVDVDGEPLVVCTGFYKLWTWAPL
FT                   RDEWLERPLASAFAAEYPDAENDIDSVAVAVFDGRVVLAAGGDEQGASIWDLFSGELLR
FT                   GNTHNGPYIASIATVKNAGPPLFVASSGIHWDGVELWGLGEEPPIELDAGSVWGLATAR
FT                   IDGRSLVAGGNEEGVTVWDVANGEEVASFYVDDEQRSYAVGFSEVDGRPVVVAGTDSGK
FT                   VYVFDLAAGEDDDPIHEPATGHEGGINALDIAVVGDRPVAVTGGEDGTVRIWDLAGGRP
FT                   VGPPLTGHDARVEAVAVTTLRDRPVALTAGRDGAVRVWDLAL"
     atgtccgacg aacgtttgat tctgagcagc gtggcgcccg gcggcccggt ccacggcctt        60
     gccgtcgtcg atgtggacgg ggagccattg gtggtgtgca ccggcttcta caagctgtgg       120
     acgtgggctc cgctgcggga cgaatggctg gagcggccat tggcgtccgc cttcgccgcc       180
     gagtacccgg atgccgagaa cgatatcgac tccgttgccg tggccgtttt cgacgggcgc       240
     gtggtgctgg ccgccggcgg tgatgagcag ggagcgtcca tctgggacct gttcagcggc       300
     gagttgctgc gcgggaacac ccacaacggg ccctatatcg cgtccatcgc cacggtgaag       360
     aacgcgggac caccgctgtt cgtggcaagt agtgggatcc actgggacgg agtcgagctg       420
     tggggactcg gcgaggagcc gccgatcgaa ctggacgccg gctccgtctg gggtctcgcc       480
     accgcacgga tcgacggccg ctcgctggtc gccgggggca acgaagaggg ggtgacggta       540
     tgggatgtcg cgaatggtga ggaggtcgcg tcgttctacg tggacgacga gcagcggtca       600
     tacgctgtcg gtttttccga ggtcgacggc cgtcctgtcg tcgtggcggg cacggactcc       660
     ggaaaggtgt acgtgttcga cctggccgcg ggcgaagacg acgatccgat ccacgaaccg       720
     gccaccggtc atgagggcgg gatcaacgcc ttggacatcg ccgtggtcgg cgaccggccg       780
     gtcgcggtga ccggcggtga ggacgggacc gtacggatct gggacctcgc cggcggtcga       840
     cccgtcgggc cgccgctgac cggccacgat gcgcgcgtcg aagcggtggc ggtcaccacg       900
     ttgcgggatc gcccggtcgc cctgaccgcc ggccgggacg gcgccgtacg cgtctgggac       960
     ctggctctct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page