(data stored in ACNUC7421 zone)

EMBL: CP002047.PE385

CP002047.PE385       Location/Qualifiers
FT   CDS_pept        complement(452089..452592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00385"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03506"
FT                   /db_xref="GOA:D7BYH8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH8"
FT                   /protein_id="ADI03506.1"
FT                   /translation="MAENNEDGPAVEELLGARLGYLLKHAQLRLAEHAGPALARFGLDA
FT                   RELAVLAVLAAGRPLSQLEAARRLGVDRTTMVALIDALESKDLVERRRSEEDRRRNVVE
FT                   LTERGMRVRADAEEAREAAEREFLGPLGEEEAARLMKALRVLVLRTPNQPLAPRGQAAR
FT                   SGRS"
     atggcggaga acaacgagga cgggcccgcg gtcgaggaac tgctcggcgc gcggctcggc        60
     tacctgctca agcacgcgca gctgaggctg gccgagcacg ccgggcccgc gctggcccgg       120
     ttcgggctgg acgcccggga gttggcggtg ctcgcggtgc tggcggccgg ccgcccgctg       180
     tcacagctgg aggccgcacg gcggctgggc gtggaccgta cgacgatggt cgcgctcatc       240
     gacgcgctgg agagcaagga cttggtggag cggcgccgca gcgaggagga ccgccgccgc       300
     aacgtggtcg agctgacgga gcggggcatg cgggtgcggg ccgatgcgga ggaggcccgc       360
     gaggcggcgg agcgcgagtt ccttggcccg ctgggcgagg aggaggcggc gcggctgatg       420
     aaggcgctgc gcgtgctcgt gctcagaact ccgaaccagc cattggcgcc aagaggtcaa       480
     gccgctcgca gcgggcggag ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page