(data stored in ACNUC7421 zone)

EMBL: CP002047.PE387

CP002047.PE387       Location/Qualifiers
FT   CDS_pept        complement(453606..454787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00387"
FT                   /product="hypothetical protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03508"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI0"
FT                   /protein_id="ADI03508.1"
FT                   /translation="MSGQDERLWDDLIERTRGRLGAMVEQFLARTMTDPSYADSELTAE
FT                   DLRRSSVESFTAILDSLRSDGTTSALVAIAEPLGTRRARQAVPLDSLLRAVRLDFTVLW
FT                   EHLADPASGMDPALLVRKAGRVWTTVDEFAAHVQEHYLAEQLAIEQANADLQRHYLAQL
FT                   FGTTRPTEAALERIAGALRVSTSGNFSVAAVSRDDGVVVRRRIRSTPRYGHVYFDYDMG
FT                   HHTLFLWPTAEPALGRLPQGVKDLFADMAVAVAPVARGLVRVRDAASAAREIMIDLPLD
FT                   SSGVATLSDRWRSVTRHLLAGVGCDLGQIVFPYLEKCTDLERRKILETVATYLDTGSLG
FT                   DTGRLLECHRNTVLNRLNTFEKYTGLDVQRPYDAAAVIIALEWQGAEWQGARP"
     gtgtccggtc aggacgaacg gctctgggac gatctcatcg agcggacgcg cggtcgtttg        60
     ggcgcgatgg tggaacagtt cctcgcacgc accatgacgg acccttctta cgccgattcc       120
     gaactcacag cggaggattt gcggcggtcg agcgtcgagt cgttcaccgc gatcctggac       180
     agcctgcgct cggacggaac cacgagcgcc ctggtggcca tcgccgagcc gctggggacc       240
     cggcgcgccc ggcaggccgt tccgctggac agcctgctgc gcgccgtccg gctcgacttc       300
     accgtgctgt gggaacactt ggcggacccg gcctccggga tggacccggc gctgctggtg       360
     cgcaaggccg gacgggtgtg gaccacggtg gacgagttcg cggcgcatgt ccaggagcac       420
     tacctcgccg aacagctggc catcgagcag gccaacgcgg atctccaacg gcactacctg       480
     gcccagctgt tcggcaccac acggcccacc gaggccgccc tcgagcgcat agccggtgcg       540
     ctccgcgtgt ccacatcggg caacttctct gtggccgcgg tgtcccggga cgacggagtc       600
     gtcgtgcgca ggaggatccg gagcacccca cggtacggcc acgtctactt cgactacgac       660
     atgggacatc acaccctgtt cctgtggccg acggcggagc cggccctggg cagactcccc       720
     caaggagtca aggacctctt cgccgatatg gcggtcgcgg tcgcgccggt cgccaggggg       780
     ctggtgcgcg tccgcgacgc tgcctcggcc gcgagagaga tcatgatcga cctgccgttg       840
     gacagttcgg gcgttgccac gctgtcggac cgctggcgct cggtgacccg gcacctcctg       900
     gccggggtcg gatgtgatct gggtcagatc gtcttcccgt acctggagaa gtgcacggat       960
     ctggaacggc ggaagatcct ggaaaccgtc gccacctacc tggacacggg aagcctgggc      1020
     gatacgggcc gattgctgga gtgccaccgc aacaccgtgc tgaaccggct gaacacgttc      1080
     gagaagtaca ccggccttga cgtacagcgg ccctacgacg ccgccgccgt gatcattgcc      1140
     ctggaatggc agggtgcgga atggcagggt gcccgcccct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page