(data stored in ACNUC7421 zone)

EMBL: CP002047.PE389

CP002047.PE389       Location/Qualifiers
FT   CDS_pept        455418..456677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00389"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03510"
FT                   /db_xref="GOA:D7BYI2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI2"
FT                   /protein_id="ADI03510.1"
FT                   /translation="MTIEHTATSPDAELFLRDFRSLSQIGETPGGGVDRQAATVADAQA
FT                   RAWFTALLGQYGFTVEVDAVGNVFGLLEWNPGAPYVLVGSHLDSQPLAGKFDGAYGVAA
FT                   ALHAGRRLAAGHAPAHRPKYNLAVVDWFNEEGSRFAPSMMGSSVFTGKMAAADALAIRD
FT                   TDGVSVAEALAAIGHTGSGTGPVPAACAEIHIEQGRSLEDSDTTIGLVHSCWAAEKFTV
FT                   TVHGEQAHTGSTVIADRRDALLGASRLVVLLRELADRYPAGALHTSVGQLTVLPNSPVV
FT                   VPRRVDLTMDLRSADEDVLAEAKQLLEQGIKLIEDEVRVRIEVRGSHAWGVRPYPAAGV
FT                   DLARDCADSLGLTSRPVYTLAGHDSINMNDVVPTVMLFVPSREGVSHNEGEFTGDSDLC
FT                   AGVDVLTEVVRRLCEGALDG"
     atgaccatcg agcacaccgc caccagcccc gacgccgagc tgttcctgcg ggacttccgt        60
     tcgctgagcc agatcggcga gacacccggc ggaggcgtcg accggcaggc cgcaaccgtc       120
     gcggacgccc aggcgcgggc ctggttcacc gccttgctcg gccagtacgg gttcacggtc       180
     gaggtcgacg cggtgggcaa tgtcttcggg ctcctggagt ggaacccggg agccccgtac       240
     gtactggtcg gctcccacct cgacagccag cccctggccg gcaagttcga cggggcgtac       300
     ggtgtcgcgg ccgccctgca cgcgggccgg cggctggccg ccggccacgc ccccgcgcac       360
     cgcccgaagt acaacctggc ggtggtggac tggttcaacg aggaggggtc gcggttcgcc       420
     ccgtccatga tgggcagctc ggtcttcacc gggaagatgg cggcggcgga cgctctggcc       480
     atccgggaca cggacggggt gtccgtcgcc gaggccctgg ccgcgatcgg gcacaccggg       540
     tccgggaccg ggccggtgcc cgccgcgtgc gccgagatcc acatcgagca gggacggtcc       600
     ctggaggact ccgacaccac catcggactc gtccactcct gctgggcggc ggagaagttc       660
     accgtcaccg tgcacggcga gcaggcgcac accgggtcca ccgtcatcgc cgaccgccgt       720
     gacgcccttc tcggcgcatc ccgtctggtg gtgctgctgc gcgagctggc ggaccgctat       780
     ccggccggtg cgctgcacac ctccgtcgga cagctcaccg tgctgcccaa ctcccccgtc       840
     gtcgtccccc gccgggtcga tctgacgatg gatctccgct ccgccgacga ggacgtactc       900
     gccgaggcca agcagctgct ggagcagggc atcaagctca tcgaggacga ggtgcgggtc       960
     cggatcgagg tccgcggttc ccatgcgtgg ggtgtccgcc cgtacccggc ggccggggtg      1020
     gacctcgccc gcgactgcgc cgactccctg gggctgacca gccggccggt gtacacgctg      1080
     gccggacacg actccatcaa catgaacgac gtcgtgccga ccgtgatgct gttcgtcccc      1140
     agccgcgagg gcgtcagcca caacgagggc gagttcaccg gggacagcga cctgtgcgcc      1200
     ggagtcgatg tgctgaccga ggtggtccgg cggctgtgcg agggcgcgct cgatggctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page