(data stored in ACNUC7421 zone)

EMBL: CP002047.PE39

CP002047.PE39        Location/Qualifiers
FT   CDS_pept        complement(36191..36592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00039"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03160"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY3"
FT                   /protein_id="ADI03160.1"
FT                   /translation="MATIDVFNHNVPAESDFGYSQAIKSGDLIHVSGQLSLDEAGEFLY
FT                   ADDFDAQLKQTYVNLDKVLDHYGVTRNQVVSQTLYVVNLRQNAAATAEGNLAYFGHHRP
FT                   ASTVFGVTELTFPGQVIEISFVIDTKLPA"
     ttggccacca tcgatgtctt caaccacaat gtgcctgccg agagtgactt cggctactcg        60
     caggcgatca agtccgggga tctgatccac gtctccggac agctctcact cgacgaggcg       120
     ggcgagttcc tctacgcgga cgatttcgac gcccagctca agcagaccta cgtcaacctg       180
     gacaaggtcc tggaccacta cggcgtcacc cggaaccagg tcgtctcgca gaccttgtac       240
     gtggtgaacc tgcgccagaa tgccgcggcg acggcagagg gcaacctggc gtacttcggc       300
     caccaccgtc cggccagcac ggtcttcggc gtcaccgaac tgaccttccc cggccaggtc       360
     atcgagatca gcttcgtcat cgacacgaag ctgcccgcct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page