(data stored in ACNUC7421 zone)

EMBL: CP002047.PE392

CP002047.PE392       Location/Qualifiers
FT   CDS_pept        complement(459323..460534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00392"
FT                   /product="putative transcriptional regulator, PucR family
FT                   protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03513"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI5"
FT                   /protein_id="ADI03513.1"
FT                   /translation="MSPDEDKATMEHLQTPHPALPPADPHVAALASQCLEEIDSLVSEW
FT                   AEYVGPVRASYSDLVSPQDFRDSAWQAFELLLRTVAQLPVPEHIAGVSERVGEQRARQG
FT                   VPLDALLQAARVDFRVVWAALVRRAGEEGRAQLVTSAYYVWEAVERHVTGIMTTYQRTV
FT                   LEMGRRREDERRLWFTRLLDSDGRNPTVVQDAALALGFQVSGRFLCAVAPGGGEASLRG
FT                   AANALRNLGTPMQQQAVASDMVLVVQLGSRVARETVLAHLLGTPCGVSPEVTGVTEVPR
FT                   AVKLATATARVLPRDATGPRRLEDSWLDVLVHRAGDLGRDLAADVLGGLHEAVPRVEAD
FT                   RLLETVRVHLSGSGSVADTAAALYCHRNTIQQRLNRFAELTGRDPRRPEDAALVVLALS
FT                   AGRL"
     atgagcccag acgaggacaa ggccaccatg gagcacctgc agacgccaca cccggccctg        60
     cccccggcag acccccatgt ggccgccctg gcgagccagt gtctggagga aatcgacagc       120
     ctggtgagcg aatgggccga atacgtcggg ccggtccgcg cctcctactc cgacctcgtg       180
     tccccgcagg acttccgcga cagcgcgtgg caggcgttcg aactcctgct gcgcaccgtc       240
     gcccaactgc cggtgccgga acacatcgcc ggcgtgtccg agcgggtcgg cgaacagcgc       300
     gcccgccagg gcgtgccgct ggacgcgctg ctgcaagccg cccgggtgga cttccgggtc       360
     gtctgggcgg ccctggtgcg gcgcgcgggc gaggagggca gagcacagct ggtcacctcg       420
     gcctactacg tatgggaggc ggtcgagcgc cacgtcaccg gcatcatgac cacctaccag       480
     cggaccgtcc tggagatggg gcggcgcagg gaggacgagc gtcgcctgtg gttcacccgg       540
     ctcctggaca gcgacggccg taaccccacc gtggtccagg acgccgcgct ggccctcggc       600
     ttccaggtgt ccgggcgttt tctgtgcgcg gtggcgcccg ggggtggcga ggcgtcgctg       660
     cgcggggccg cgaacgcgct ccgcaacctc ggcaccccga tgcagcagca ggcggtcgcc       720
     tcggacatgg tcctggtcgt ccaactgggc tcccgggtgg cccgggaaac ggtgctggca       780
     cacctcctcg ggacgccgtg tggtgtctcg cccgaggtga ccggggtgac cgaggtgccc       840
     cgcgcggtga agctggccac cgccaccgcc cgcgtactgc cccgcgatgc cacgggaccg       900
     cgccggctgg aggacagctg gctcgatgtc ctggtccacc gggccgggga cctggggcgc       960
     gatctggcgg ccgatgtact cggcgggctc cacgaagcgg ttccccgtgt ggaggcggac      1020
     cggctgctgg agaccgtccg ggtgcatctg tccggcagcg gatccgtcgc ggacacggcc      1080
     gccgccctgt actgccaccg caacacgatc cagcagcgcc tcaaccgatt cgccgaactc      1140
     accggccgcg acccccgacg acccgaggac gcggccctgg tggtcctggc actgagcgcc      1200
     ggccgtctgt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page