(data stored in ACNUC7421 zone)

EMBL: CP002047.PE398

CP002047.PE398       Location/Qualifiers
FT   CDS_pept        468922..470592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00398"
FT                   /product="hypothetical protein"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03519"
FT                   /db_xref="GOA:D7BYJ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ1"
FT                   /protein_id="ADI03519.1"
FT                   /translation="MTFLREAISRIGTTLDLGHTARVLVTSAVPRFADFASVHLHDHVT
FT                   AQDDASVPQQPPGSVVMHRVASAHTDDPGAGELHAERTFVYQADTAMARFLALVEPILI
FT                   PRVDQDTLRQLPQELDSPAARSVLSGSSVMLVPLTVRGLVLGFMVFGRKPERLAFSPVD
FT                   LAACQEMAEQAALSLDNARLYGHEARTSAVLQRSLLPTRPPRLPSVEIAYRYHPCSRTT
FT                   QVGGDWLDVIPLPRHRVGLVIGDVAGHGLHAAVAMGQLRTAVRTLATMDLPPAQLLAHL
FT                   DQLAQHLGHVPLTTCLYAIYDPIAGRAAFASAGHLPPVLLRPDGTDELLEIPVGAPIGV
FT                   GSIAFDTLDVSIDSGSLLVLYTDGLVEARGHDIEEGLLAVRCGLAATHPSLDEACESLL
FT                   RQQHPNGDHDDIAVLMARLHSIPDDKVATWRFPPQPQQVSVARRRVRDTLTAWGLDPLC
FT                   DTTELLAGELLTNAIRHTTHPVGLRLVHTDTLLCEVTGDQQITPMLPHTPGTQASHCAI
FT                   TLLQKLATRWGCSDTSTGRTVWFESNLPAPASRATARRL"
     gtgacattcc tccgggaggc gatcagccgt atcggcacca ctctggacct cggccacacg        60
     gcccgcgtac tggtcacctc ggccgtaccg cggttcgccg acttcgcctc cgtccatctg       120
     cacgatcacg taaccgccca ggacgacgcc tccgttccgc agcagccgcc gggctccgtc       180
     gtgatgcacc gtgtggccag cgcgcacacc gacgaccccg gcgccggaga actccacgcg       240
     gagcggacct tcgtctacca ggccgacacg gccatggccc ggtttctcgc gctcgtcgaa       300
     cccatcctca tcccccgggt cgaccaggac accctgcgcc agctgccgca ggagctcgac       360
     agcccggccg cccggtcggt gctctccggc tcatccgtca tgctggtgcc gctgaccgta       420
     cggggcctgg tcctcggctt catggtgttc ggtcggaaac cggagcggct cgccttcagc       480
     ccggtggatc tggccgcctg ccaggagatg gccgagcagg cggccctgtc tctggacaac       540
     gcccgcctgt acggccatga ggccagaaca tccgccgtgc tgcagcgcag ccttctgccc       600
     acgcggccac cccgtctgcc cagcgtggag atcgcctacc gctaccaccc gtgcagccgt       660
     accacacagg tgggtggcga ctggctggac gtgatcccgc tgccccgcca ccgggtcggc       720
     ctcgtcatcg gcgatgtggc gggccacgga ctgcacgccg ccgtggcgat gggccaactg       780
     cgcaccgccg tcaggaccct cgccaccatg gaccttccgc ccgcacagct gttggcccac       840
     ctcgatcagc tggcacaaca cctcggccac gtccccctga ccacctgcct gtacgccatc       900
     tacgacccca tcgcgggccg agccgccttc gccagcgccg gccatctgcc gcccgtcctc       960
     ctgcgccccg acggcacgga cgaacttctt gagattcccg tcggcgcgcc catcggtgtg      1020
     ggaagtatcg ccttcgacac gctggacgtg tccatcgact ccggcagtct tctcgtcctt      1080
     tacaccgacg gcctggtgga ggcacgcgga cacgacatcg aggaagggct cctcgccgta      1140
     cgctgcggcc tcgccgccac acacccctcg ctggacgagg cgtgcgagtc cctgctccgg      1200
     cagcagcacc ccaacggcga ccacgacgac atcgccgtcc tgatggcccg cctgcacagc      1260
     atccccgacg acaaggtggc cacctggcgc tttccgcctc agccccaaca ggtgagcgtc      1320
     gcccggcgcc gggtgcgcga caccctcacc gcatggggtc tggacccact ctgtgacacc      1380
     accgaactcc tcgccggtga actactcacc aacgccatcc gccacaccac ccatccggtc      1440
     ggcctgcgcc tggtgcacac cgacacactc ctgtgtgagg tcaccggcga ccagcagatc      1500
     acgcccatgc tcccgcacac ccccggcacc caggcgtccc actgcgccat caccctgctc      1560
     cagaagctcg ccacgcgatg gggctgctcc gacacctcaa ccggcagaac cgtctggttc      1620
     gaaagcaacc tgcccgcccc ggcgtcccgc gcgaccgcgc gccggctctg a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page