(data stored in ACNUC7421 zone)

EMBL: CP002047.PE399

CP002047.PE399       Location/Qualifiers
FT   CDS_pept        470936..471109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03520"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ2"
FT                   /protein_id="ADI03520.1"
FT                   /translation="MTTDPTEKAAYPAAAIAASAPTWRRYTPLHDAGASSTRAARKVIS
FT                   ASSGTVSRPFGP"
     gtgacgaccg atcccaccga gaaggccgcg tacccggccg cggccatcgc cgcatccgcc        60
     cccacatggc gcagatacac accgctccac gacgcggggg cgtcctccac cagggcggcg       120
     aggaaggtca tcagcgcgag cagcggtacg gtcagccgcc ccttcggccc ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page