(data stored in ACNUC7421 zone)

EMBL: CP002047.PE40

CP002047.PE40        Location/Qualifiers
FT   CDS_pept        36696..37079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03161"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY4"
FT                   /protein_id="ADI03161.1"
FT                   /translation="MVTKQLLRGLPENADLRRADSLAREIFSDVANKWALLIIEALGER
FT                   TLRFSELRNEIEGISHKMLTQNLRMLERNGLVNRTVHPTVPPRVEYTLTEPGRALRTTV
FT                   DAICGWTHQYLGHIEDARRRFGD"
     atggtgacca agcagctact caggggcctg cccgagaatg cagacctcag gcgcgcggac        60
     tccctggcgc gggagatctt ctcggacgtc gccaacaaat gggcgctcct gatcatcgag       120
     gcgctcggcg agcgcaccct gcgcttcagc gagctgcgga acgagatcga gggcatcagc       180
     cacaagatgc tcacccagaa cctgcgcatg ctggagcgca acggcctggt caaccggacg       240
     gtgcacccca ccgtgccgcc acgggtcgag tacaccctca ccgaaccggg ccgcgcactg       300
     cgcaccacgg tcgacgccat atgcggctgg acccaccaat acctcggtca catcgaggac       360
     gcacgccgtc gcttcggcga ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page