(data stored in ACNUC7421 zone)

EMBL: CP002047.PE400

CP002047.PE400       Location/Qualifiers
FT   CDS_pept        471137..471541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03521"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ3"
FT                   /protein_id="ADI03521.1"
FT                   /translation="MAWLPGRVGTVCRAGSTSGWSPQAATADTTASRTAMDTNCAVSGM
FT                   LRGRRGDSGQPARDGADAADGVHGVEHRAAVLLLDGDRLGVHRHGRTPSALTVRLPRRR
FT                   TSSPPAWLPASAPSSLSNTGFGQIFGVRRW"
     gtggcctggt tgcccggccg ggtcggcacg gtctgccgcg ccggctccac atccggctgg        60
     agcccgcagg ccgccaccgc ggacacgacg gcgagcagga ccgccatgga cacgaactgc       120
     gccgtcagcg gcatgctcag gggacgccgt ggcgactccg gccagcccgc ccgtgacggc       180
     gccgacgctg cggatggcgt gcatggagtt gagcaccgcg cggccgtact gctgctggac       240
     ggagaccgcc tgggcgttca tcgccacgga cgtaccccca gcgcgctcac cgtacggctg       300
     ccgaggcgtc gcaccagcag cccgcccgcc tggctgccgg ccagcgcgcc gagctcgctg       360
     tcgaacaccg gtttcggcca gatcttcgga gtcaggaggt ggtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page