(data stored in ACNUC7421 zone)

EMBL: CP002047.PE401

CP002047.PE401       Location/Qualifiers
FT   CDS_pept        complement(471528..472442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00401"
FT                   /product="NmrA family protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03522"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ4"
FT                   /protein_id="ADI03522.1"
FT                   /translation="MTTETPANPDSPILVTGATGKQGGATARRLLAGGWPVRALVRDLT
FT                   APGAAELAAAGAQLVRGDFDDPASLRPALDGAAAVFGIPPVSYGPTGPETELEAARGRT
FT                   LIDAAAAAGIEQIVFSTVASSSAASWSWEGKTLIEEYLRDHIALPTVLRPVRFMTNYLS
FT                   VGAIGIDGISRGVHRHLFPPHEPMQIIALEDIAEFAALAFADPARFAGRTLELAGDEPT
FT                   PVEAAAAIAEATGAPIRYEQLTDGEAAALGPEIAETKKRWEAGHRWHADIEALRVIHPG
FT                   LRTLTDWLTESGAAAIRARLTTS"
     atgaccaccg agacaccggc caaccccgac tccccgatcc tcgtcaccgg cgccaccggc        60
     aagcaaggcg gcgccaccgc ccggaggttg ctggccggag ggtggccggt gcgagccctg       120
     gtgcgcgacc tgactgcccc cggcgctgcc gagctggctg ccgcgggcgc ccagctcgtg       180
     cgcggcgact tcgacgatcc ggccagtctg cggcccgcgc tcgacggcgc cgccgcagtg       240
     ttcggcatac cgcccgtgtc ctacggaccg accggacccg aaacggagct cgaagcggcc       300
     cgcggccgga cactgatcga cgccgcggcc gcggcgggga tcgagcagat cgtgttcagc       360
     accgtcgcct cgtcatcggc cgcatcgtgg agttgggagg ggaaaacgct gatcgaggag       420
     tatctgcgcg accacatcgc gctacccacc gtactgcgcc cggtccggtt catgaccaac       480
     tatctctccg tcggggcgat cggcatcgac ggcatttccc gcggtgtgca ccggcatctc       540
     ttccctccgc acgagcccat gcagatcatc gcgctggagg acatcgccga gttcgccgcc       600
     ctcgcgttcg cggacccggc ccgattcgcc ggacgcaccc tggaactggc cggcgatgaa       660
     ccgaccccgg tcgaggccgc tgccgccatc gccgaggcca ccggcgctcc gatccggtac       720
     gaacagctca ccgacggcga ggccgccgcg ctcggcccgg aaatcgccga gacgaaaaag       780
     cgctgggagg ccggtcaccg ctggcacgcc gatatcgagg cactacgcgt catccacccc       840
     ggactgcgca ccctcaccga ctggctcacc gaatccggtg ccgccgccat ccgcgcccgt       900
     ctcaccacct cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page