(data stored in ACNUC7421 zone)

EMBL: CP002047.PE403

CP002047.PE403       Location/Qualifiers
FT   CDS_pept        473450..474043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00403"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03524"
FT                   /db_xref="GOA:D7BYJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ6"
FT                   /protein_id="ADI03524.1"
FT                   /translation="MRAATARTTHTIGSGVMMIEVCGLTKRYGEVLAVDDLTFAVRPGE
FT                   VTGFLGPNGAGKSTTLRMILGLDAASSGTATVGGRPYSAQPAPLKAVGALLDAGAVLPS
FT                   RTAYHHLLALAAGNGIPRSRVAKVLIVQAFAPALPGAVGDRVEKYWPPIAGGQIITGYR
FT                   DPALLAPWSGLAVMAGCVAVLLTVAFIVFRKRDA"
     atgcgcgcgg cgaccgcgcg caccacgcac accatcggct ctggagtcat gatgatcgaa        60
     gtctgcggac tcaccaagcg ctacggggag gtcctggccg tcgacgacct gacgttcgcc       120
     gtccgcccag gagaagtgac cgggttcctc ggtcccaacg gtgccgggaa gtcgaccaca       180
     ctgcggatga tcctggggct ggacgccgcc agttcgggga ccgccacggt cggcgggcgc       240
     ccgtattccg cgcagccggc gccgctgaag gccgtcggcg cgctgttgga cgcgggtgcg       300
     gtgctgccca gccgcacggc ctaccaccat ctgctggcgc tggcggccgg caacgggatt       360
     ccgcgtagcc gggtggcgaa ggtgctgatc gtgcaggcgt tcgcgccggc cctgcccggt       420
     gcggtcggcg accgggtgga gaagtactgg ccgcccatcg cgggcggaca gatcatcacc       480
     ggctaccgtg atccggcgct gctggccccc tggtccgggc tcgccgtcat ggcgggatgt       540
     gtcgcggtcc tgctgacggt ggcgttcatc gtcttccgca agcgcgacgc atag             594
//

If you have problems or comments...

PBIL Back to PBIL home page