(data stored in ACNUC7421 zone)

EMBL: CP002047.PE404

CP002047.PE404       Location/Qualifiers
FT   CDS_pept        474093..474797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00404"
FT                   /product="response regulator receiver"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03525"
FT                   /db_xref="GOA:D7BYJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ7"
FT                   /protein_id="ADI03525.1"
FT                   /translation="MTASERLLVVEDEPTLRELLSASLRLAGFAVAPVATGAQALAAVR
FT                   EQRPDLIVLDVMLPDFDGFEVVRRLRGQHPSAAAGHPPVLFLTARDAPEDRISGLRAGG
FT                   DDYVTKPFNLEELVLRIRAILRRTSGRQADGRLVVGMLELDPDSHQVTRDGRPVQLSPT
FT                   EFSLLRVLMENAGQVLSKSQLLELVWQYDFGGDDSIVASYISYLRRKVDLDEPKLIHTV
FT                   RGTGYVLRRPRQ"
     atgacggctt cggaacggct actggtggtg gaagacgagc cgacgctgcg cgaactgctg        60
     tccgcgagcc tgcggctggc cggtttcgcg gtggcgccgg tcgcgaccgg cgcgcaggcg       120
     ctggccgcgg tgcgggagca gcgccccgac ttgatcgtgc tggatgtgat gctgcccgac       180
     ttcgacggct tcgaggtcgt ccgcaggctg cgcgggcagc atccctccgc ggcggcgggg       240
     catcccccgg tgctgttcct caccgcccgc gatgcgcccg aggaccggat cagcgggctc       300
     agggcgggcg gtgacgacta tgtcaccaag ccgttcaacc tggaggagct ggtgctgcgc       360
     atccgggcca ttctgcgccg caccagtggt cggcaggccg acggccggtt ggtcgtcggc       420
     atgctggagc tggaccccga cagccatcag gtgacccggg acgggcgccc cgtccagctc       480
     tccccgaccg agttcagcct gctgcgcgtg ctgatggaga acgccgggca ggtgctgtcg       540
     aagtcccaac ttctggagct ggtctggcag tacgacttcg ggggcgacga cagcatcgtc       600
     gcctcgtaca tcagctatct gcggcgcaag gtggacctgg acgagccgaa gctgatccat       660
     acggtgcgcg gcaccggcta tgtgctccgc aggccccggc agtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page