(data stored in ACNUC7421 zone)

EMBL: CP002047.PE405

CP002047.PE405       Location/Qualifiers
FT   CDS_pept        474794..476359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00405"
FT                   /product="histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03526"
FT                   /db_xref="GOA:D7BYJ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ8"
FT                   /protein_id="ADI03526.1"
FT                   /translation="MNKSPLRKSRFSLRGGLSLRGRFSLRGRFSLRGRLLAISLLLLVV
FT                   ALLGSNALVVTLLQRDLVHRLDDRLRAAATATTRLTDPSGAAGDQAPQLRATVEQHLTG
FT                   DSYLAYLGSNGRVRRVIRPAVHSAPVLPPLDATAVRERDRRPFEAPAVDGDESWRVLAV
FT                   PLNATGRARKGPKARAADTHSVVVAGSLAEVDSTITQLGARMLVIDSLVLALLGVAGWF
FT                   AVRAGLRPLRRIETTAAAIADGDLSSRVPELAASRTELGRLATALNGMLDRIEASDAAR
FT                   AAAAELMRRFIADASHELRTPLFGIKGFTELYRMGGMPERTDVDAAMSRIEREAARLVR
FT                   LVEDLLLLARLDEHAAAADLPLRLTPMDLRTLAADALHDLRALDPLRPVTLTGPGGGPP
FT                   GGAPVLGDEARLRQVTSNLVGNAVAHTPPGTPVRIGVGVGAEDGLAVLELQDEGPGMSQ
FT                   EQAARAFDRFYRADDARGRTESGGAGLGLAIVASLVTAHHGRVEVRTAPGEGATFRVLL
FT                   PLHG"
     gtgaacaaga gccccctgcg caaaagccgc ttctcgctgc gcggcgggct ctcgctgcgc        60
     ggccggttct cgctgcgcgg ccggttctca ctgcgcggcc ggctgctggc gatctccctg       120
     ctgctgctcg tggtcgccct gctcggcagc aacgccctgg tcgtcaccct gctccagcgg       180
     gacctggtgc atcggctgga cgaccggctc cgcgccgccg ccacggccac cacgcgcctg       240
     accgatccgt ccggcgcggc gggcgatcag gcaccgcagc tgcgcgccac cgtggagcag       300
     cacctgaccg gcgacagcta tctcgcctat ctcggttcga acggccgtgt gcggcgggtc       360
     atccggccgg ccgtgcacag cgctcccgtg ctgcccccgc tcgacgctac ggccgtccgc       420
     gaacgcgacc gccggccttt cgaggccccg gccgtcgacg gcgacgagtc ctggcgagtg       480
     ctcgccgtac ctctcaacgc gacgggacga gcgcgcaagg gtccgaaggc gcgggccgcg       540
     gacacccaca gcgtcgtcgt ggccggctcg ctcgccgagg tcgactctac gatcacgcag       600
     ctcggcgccc ggatgttggt gatcgactcc ctggtgctgg ccctgctcgg cgtggccggg       660
     tggttcgccg tacgcgccgg gctgcgtccg ctgcggcgta tcgagaccac cgcggcggcc       720
     atcgcggacg gcgacctgtc cagccgggtc ccggagctgg ccgcctcacg taccgaactc       780
     ggccgtctgg ccacggcgct caacggcatg ctggaccgga tcgaggcgag tgacgcggcg       840
     cgggccgccg ccgccgagct catgcgccgc ttcatcgcgg acgccagcca tgagctgcgt       900
     acccccctct tcggcatcaa aggtttcacc gagctgtacc ggatgggcgg catgcccgaa       960
     cgcaccgatg tcgacgccgc gatgagccgc atcgagcggg aagcggcgcg gctggtccgg      1020
     ctggtcgagg acctgctgct gctcgcccgt ctcgacgagc acgccgccgc cgcggacctc      1080
     ccgctccggc tcacccccat ggacctgcgc accctggccg ccgacgccct gcacgacctc      1140
     cgcgcgctcg atccgctgcg ccccgtcacc ctcaccggcc ccggcggcgg cccgccgggt      1200
     ggcgcgccgg tgctcggcga cgaggcgcga ctgcggcagg tgacctccaa cctcgtcggc      1260
     aacgcggtgg cccacacccc acccggcacc ccggtccgga tcggtgtcgg cgtcggcgcc      1320
     gaggacggcc tggcagttct ggagctccag gacgagggtc cggggatgtc ccaggagcag      1380
     gccgcccgtg ccttcgaccg cttctaccgc gcggacgacg cccgcggccg taccgagagc      1440
     gggggcgcgg gcctcggcct cgcgatcgtc gcctccctgg tgacggccca ccacggccgg      1500
     gtggaggtcc gcacggcccc gggcgagggc gccaccttcc gcgtactcct ccccctgcac      1560
     ggctga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page