(data stored in ACNUC7421 zone)

EMBL: CP002047.PE406

CP002047.PE406       Location/Qualifiers
FT   CDS_pept        complement(476384..478051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00406"
FT                   /product="antibiotic ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03527"
FT                   /db_xref="GOA:D7BYJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ9"
FT                   /protein_id="ADI03527.1"
FT                   /translation="MPPSPLLAHDLVRTLGSRRVLDGVSLVASPGHRIGLIGENGVGKS
FT                   TLLRLLAGVDEPDAGRVERPADLGFLQQEMPYDAEATINDVIDDALREAREDLVELERL
FT                   SDELARTPQDAPGYAALLEAYGGRLERAEERGAWDADRQAALVLDGLGLGAVAHGRTLG
FT                   SLSGGQRGRLALAALLVRRPPALLLDEPTNHLDDGAAAFLEEQVRGLPGVVLLASHDRA
FT                   FLDAVCTDLIDLDPAVAGPVRYGGNYSAYLSEKHAERARWERRHAEEQQELDALRHTAG
FT                   VTAHALAPNRGRRDNEKMGYGHRAGRVQNQISRRVRNATRRLEELERTQVGTPPPPLRF
FT                   QHTVLAKESADGTLVALRDARVPGRLAVGRLDVAASERLLVTGGNGAGKSTLLSVLAGR
FT                   LAVQGEVRRRRGLTVGLLAQDIVFDRPERTVRDTYALSLGAERTQTVPLDSLGLMHKAD
FT                   LDKAVGHLSAGQRRRLALALLVARPPALLLLDEPTNHLSPRLCDELEEALGTGPGAIVV
FT                   ASHDRWLRKRWQGREMRLDPGAPPDMAADSPPVSPVMG"
     atgcccccat cgcccctgct cgcccatgac ctcgtccgca ccctcggcag cagacgggtg        60
     ctcgacggcg tctccctcgt cgcctccccc ggccaccgca tcgggctgat cggggagaac       120
     ggcgtcggca agtcgacttt gctgcgcctg ctcgccgggg tggacgaacc cgatgccggg       180
     cgggtcgagc gcccggccga cctgggcttc ctccagcagg agatgccgta cgacgccgag       240
     gccaccatca acgacgtcat cgacgacgcc ctgcgcgagg cacgcgaaga cctcgtcgag       300
     ctggaacgcc tctccgacga gctcgcccga acaccacagg acgcccccgg ctacgcggcg       360
     ttgctggagg cgtacggcgg gcggctggag cgggccgagg agcgcggggc gtgggacgcc       420
     gaccggcagg ccgcgctcgt cctcgacggg ctcggcctgg gtgcggtcgc gcacggccgt       480
     accctcgggt cgctctccgg cggccagcga ggccggctcg cgctggccgc cctgctggtc       540
     cgccgtcccc cggcgctgct gctggacgag ccgaccaacc acctcgacga cggagccgcg       600
     gccttcctgg aggagcaggt acgcggtctg cccggcgttg tgctgctggc cagccatgac       660
     cgggcctttc tcgacgccgt ctgcaccgat ctgatcgacc tcgaccctgc cgtggccggc       720
     ccggtccgct acggcggaaa ctacagcgcc tatctgtcgg agaagcacgc cgagcgggca       780
     cgctgggagc ggcgccacgc cgaggagcag caagaactcg acgcgctgcg gcacacggcc       840
     ggtgtcaccg cccacgccct cgccccgaac cgtgggcgca gggacaacga gaagatgggc       900
     tacgggcacc gcgccggccg ggtgcagaac cagatctccc gccgggtgcg caacgccacc       960
     cgcagactgg aggaactgga gcgcacacag gtcggcacgc cgccaccgcc cctgcggttc      1020
     cagcacaccg tgctcgcgaa ggagtcggcg gacggcaccc tggtggcgct gcgcgacgcg      1080
     cgggtcccgg gccgtctggc cgtcgggcgt ctcgatgtgg cggcgtcgga acggctgctt      1140
     gtcacgggcg gcaacggggc cggaaagtcc acgctgttga gcgtgctcgc cgggcggctc      1200
     gccgtacagg gcgaggtgcg gcggcggcgc gggctgacgg tggggctgct ggcccaggac      1260
     atcgtattcg accggccgga acgtacggtc cgggacacct acgcactctc gctcggcgcc      1320
     gaacggacgc agaccgtccc gctggactcg ctgggcctga tgcacaaagc ggacctggac      1380
     aaggcggtcg gccatctgtc ggccggtcag cggcgccgcc tcgcgctggc gctgctggtc      1440
     gcgcgcccgc ccgcgcttct gctgctcgac gagcccacga accatctctc gccgcggctg      1500
     tgcgacgagt tggaggaggc cctggggacc ggccccggcg cgatcgtcgt ggccagtcac      1560
     gaccggtggc tgagaaagcg ctggcagggc cgggagatgc ggctggaccc cggcgcgccg      1620
     ccagacatgg ctgcagattc gccacctgtc agtccggtga tgggctga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page