(data stored in ACNUC7421 zone)

EMBL: CP002047.PE407

CP002047.PE407       Location/Qualifiers
FT   CDS_pept        complement(478133..479767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00407"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03528"
FT                   /db_xref="GOA:D7BYK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK0"
FT                   /protein_id="ADI03528.1"
FT                   /translation="MSDAAIVCSNVSFTWPDDTPVFQDLSVTVGTGRTGLVAPNGSGKS
FT                   TLLKLIAGELRPGAGSVSLQGTLGYLPQSLPLTGELTVAEVLGVAAVIRAIDAVESGDV
FT                   DEKHFTTIGDDWDIEERTRAQLDRLGLTDLTLDRRLGTLSGGQVVSLGLAAQLLKRPDV
FT                   LLLDEPTNNLDLDARHKLYDVLGDFNGCLLLVSHDRALLDRMERIAELDSDELRFHGGN
FT                   FTEYEEAVRAEQEVAEKNLRSAEQELKREKREMQQARERAERRAGNAARNLKNAGLPRI
FT                   FAGNMKRGAQESAGRAGQMHASRVSEAKSRVDEAGRALRDEQRITLDLPDTVVPAGRTL
FT                   FLGEAMQVRHGERPVFTGKGVDLTIRGPERIALTGTNGAGKSTLLRLINGDPAMDSGEI
FT                   KRADGRIAYLSQRLDVLDRSRTVAENFAAFAPQRPQAERMNLLARFLFRGARAHLPVGV
FT                   LSGGELLRATLACVLCAEPAPQLLLLDEPTNNLDLVSVAQLESALGSYQGAFVVVSHDE
FT                   RFLAETGVDRWLRLADGELTETGAPQR"
     atgtccgatg ctgccatcgt ctgctcgaac gtctccttca cctggcccga cgacacaccc        60
     gtcttccagg acctgtccgt gaccgtgggc accggccgta cggggctggt cgctccgaac       120
     ggctccggca agagcaccct gctcaagctg atcgccggcg agctgcggcc cggcgccgga       180
     tccgtctcgc tgcaaggcac cctcggctat ctgccccaga gcctccccct caccggcgaa       240
     ctcacggtgg ccgaggtgct gggtgtggca gcggtcatcc gggccatcga cgccgtcgag       300
     tccggcgacg tcgacgagaa acacttcacg accatcggcg acgactggga catcgaggaa       360
     cgcacccgcg cccagctcga ccgcctgggc ctgaccgacc tcaccctgga ccggcggctc       420
     ggcacgctca gcggcggtca ggtcgtctcc ctcgggctcg cggcccaact gctcaagcgg       480
     cccgatgtgc tgctgctcga cgagcccacc aacaacctcg acctcgacgc ccgccacaag       540
     ctctatgacg tgctggggga cttcaacggc tgcctgctgc tcgtcagcca cgaccgggcc       600
     ctgctcgacc gcatggagcg gatcgccgaa ctcgacagcg atgaactgcg tttccacggc       660
     ggcaacttca ccgagtacga ggaggcggtg cgggccgagc aggaggtcgc cgagaagaac       720
     ctccgcagcg ccgaacagga gctcaagcgg gagaagcggg agatgcagca ggcccgtgaa       780
     cgcgccgagc gccgcgccgg caacgccgcc cgcaacctca agaacgccgg actgccgcgt       840
     atcttcgccg gcaacatgaa gcgcggagcc caggagtccg cggggcgggc ggggcagatg       900
     cacgcctccc gggtcagcga ggccaagtcc cgggtggacg aggcggggcg tgcgctgcgc       960
     gacgaacagc gcatcacctt ggacctgccg gacaccgttg tgcccgctgg gcgcaccctc      1020
     ttcctcggcg aggccatgca ggtccgccac ggcgagcggc ccgtgttcac cggcaagggc      1080
     gtcgatctga cgatccgagg gccggaacgc atcgcgctca ccgggaccaa cggagcgggc      1140
     aagagcacgc tgctgcggct gatcaacggc gacccggcga tggacagcgg cgagatcaag      1200
     cgcgccgacg ggcggatcgc ctacctctca cagcggctgg acgtgctgga ccgcagccgt      1260
     acggtcgcgg agaacttcgc ggccttcgcc cctcagcggc cacaggccga gcggatgaac      1320
     ctgctcgccc gcttcctctt ccgcggggcg cgggcacatc tgccggtcgg ggtcctctcc      1380
     ggcggcgaac tgctccgcgc caccctggcc tgtgtcctgt gcgccgaacc ggccccccaa      1440
     ctgctgctcc tggacgagcc gacgaacaac ctggacctgg tgagcgtggc gcagctggag      1500
     agcgccctcg gctcctacca gggggctttc gtggtggtca gccatgacga gcggttcctc      1560
     gcggagaccg gcgtcgaccg gtggcttcgg ctggccgacg gcgagctcac cgagacgggc      1620
     gcgccccagc ggtaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page