(data stored in ACNUC7421 zone)

EMBL: CP002047.PE408

CP002047.PE408       Location/Qualifiers
FT   CDS_pept        480208..482514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03529"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK1"
FT                   /protein_id="ADI03529.1"
FT                   /translation="MNLRQSRLRRSAHSAALVAATFTLASGVAVTLPSATAHAADATEV
FT                   VIPSPDAYADRAERLLSTGDTGVLHQEQGSTSYLWTNTYNRQTVPVKALDGVPRESIFS
FT                   SHDQSNRVAYATTDADGATTITLLNVDQNTKSTLRLPDGYAHPQVYGGFALATRTLEDG
FT                   TYELRVLRARAGDTPYDVQVQLPADATAESEPVVLGGESTSLLIRYRTGSTHGYGILNG
FT                   ITGAVAPLPVTGEASSFRLTRDTVTWFSRQDEQGVRVLPRDGSTTTPRVVALTPQSADS
FT                   EITAYTVGRNVLWHEGDRGPLRLTPIDGAETSRVLLTDIEQGLQGSNSTLTALGRDADG
FT                   TRAIHRFTVDGSGLVFDQQLRVVAPVTVAYGSIQALGLDRGTVRYVNALQQTQRLHGKD
FT                   IGASLDPSAGDDLPVHGDSAPGRFADGGDEGLARLVADPDNGGKDVLVTGDDPDQPVDR
FT                   LPLPATDGRILDVSPEYVLYESQGPYKRQYVIDIVRDRIVKEQAPQAAALDYTTLWTPS
FT                   PDRPGTVIATDLRTGKQTDTVTLGASCTPEELQSNGTLLYWSCPEQGEAGVQDPASGLT
FT                   YPAPADEVLLGDGFIAGHNAVDGALSLTGLNEDGTTTDLGSVLALKPTSATDSRGITWT
FT                   VDRRAGKLAYVDRAETVHVFAPQHDVSALSVPDRSVPATWDRGEETAAWNAQWWLSKPA
FT                   ASWKLTLHNEDTDAEVRTWSGDSTASTVKASWDGTTTDGATAPDGAYTWTLTATPADGR
FT                   GDPVTVSGTLTVNGS"
     atgaacctac ggcaatcgcg tctcagacgt tcggcgcact ccgcggcgct ggtcgcggcc        60
     acattcacgc tcgcctcggg cgtggccgta acactcccgt cggccaccgc ccacgcggcc       120
     gacgccaccg aggtggtcat cccgtcgccc gatgcctacg cggatcgggc cgagaggctg       180
     ctctccaccg gtgacaccgg tgtgctgcac caggagcagg gctccacgag ctacctgtgg       240
     accaacacct acaaccgcca aacggtcccc gtgaaggcgc tggacggtgt gccacgggag       300
     tcgatcttct ccagccacga tcagtccaac cgggtcgcct acgccaccac cgacgcggac       360
     ggcgcgacca cgatcactct gctcaacgtc gaccagaaca ccaagtccac cctgcgactg       420
     ccggacggct acgcgcaccc ccaggtgtac ggcgggttcg ccctcgccac ccggaccctg       480
     gaggacggca catacgaact gcgggtgctg cgggcccgcg ccggggacac gccctacgac       540
     gtgcaggtgc agctgcccgc ggacgccacc gccgagtccg agccggtggt gctcggcggc       600
     gagagcacct cgctcctcat ccgctaccgc accggctcca cccacggcta cggcatcctc       660
     aacggcatca ccggcgctgt cgccccgctg ccggtcaccg gtgaggcgag cagcttccgc       720
     ctcacgcgcg acacggtgac atggttcagc cgccaggacg agcagggggt gcgtgtgctg       780
     ccgcgcgacg gcagcacgac gacaccgcgg gtcgtcgccc tcacaccgca gtccgccgac       840
     agcgagatca ccgcctacac ggtcggccgg aacgtgctgt ggcacgaggg tgaccgcgga       900
     ccgctgcggc tgacgccgat cgacggggcg gagacctcac gcgttctgct caccgatatc       960
     gaacaaggtc tgcaggggtc caacagcacg ctcaccgccc tgggccgcga cgcggacggc      1020
     acgcgggcca tccaccggtt cacggtggac ggcagcgggc tcgtattcga tcagcagctg      1080
     cgcgtggtgg cgccggtcac ggtggcctac ggctcgatcc aggcgctcgg cctggaccgg      1140
     ggaaccgtcc gctacgtcaa cgcgctgcag cagacacagc ggctgcacgg caaggacatc      1200
     ggcgcctcgc tggacccctc cgccggggac gatctgcccg tccacggcga ctccgcaccg      1260
     gggcggttcg ccgacggcgg cgacgagggc ctggcccggc tggtggcgga cccggacaac      1320
     ggtggcaagg acgtactggt gacgggtgac gacccggacc agccggtcga ccggctcccg      1380
     ctgcccgcca cggacggccg catcctggac gtctcccccg agtacgtcct ctacgagtcg      1440
     cagggcccgt acaagcggca gtacgtcatc gacatcgtcc gcgaccggat cgtcaaggaa      1500
     caggccccgc aggccgcggc cctggactac accaccctct ggacgccgtc cccggaccgg      1560
     cccggcaccg tgatcgccac cgatctgcgc accgggaagc agaccgacac cgtgacgctc      1620
     ggcgcctcct gcacacccga ggagctgcag agcaacggca cgcttctgta ctggagttgc      1680
     cccgaacagg gcgaggccgg tgtccaggac ccggcctccg ggctcaccta ccccgccccg      1740
     gccgacgaag tcctcctcgg cgacggcttc atcgccggcc acaacgccgt cgacggcgca      1800
     ctcagcctga ccggcctcaa cgaggacggc accaccaccg atctgggctc cgtcctcgcg      1860
     ctgaagccca cctccgccac cgacagccga ggcatcacct ggacggtgga ccgccgcgcg      1920
     ggcaagctcg cctatgtcga ccgggcggaa acggtgcacg tcttcgcgcc ccagcacgat      1980
     gtctccgcgc tttccgtccc ggaccgcagt gtccccgcca cctgggaccg cggcgaggaa      2040
     accgccgcct ggaacgccca gtggtggctg tccaagccgg ccgcgtcctg gaagctgacg      2100
     ctgcacaacg aggacaccga cgccgaggtg cgcacctgga gcggcgactc gaccgcgagc      2160
     accgtcaagg cctcctggga cggcaccacc accgacggcg ccaccgcccc cgacggcgcc      2220
     tacacctgga ccctcaccgc cacccccgcg gacggtcggg gagaccccgt caccgtctcc      2280
     gggacgctca ccgtcaacgg ttcatga                                          2307
//

If you have problems or comments...

PBIL Back to PBIL home page