(data stored in ACNUC7421 zone)

EMBL: CP002047.PE409

CP002047.PE409       Location/Qualifiers
FT   CDS_pept        complement(482615..483274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00409"
FT                   /product="two-component system response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03530"
FT                   /db_xref="GOA:D7BYK2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK2"
FT                   /protein_id="ADI03530.1"
FT                   /translation="MTAPIRVLVCDDQVLVRTGLVTIIDAQPDLEVVGECEDGQAAVDL
FT                   AGRLRPEVVVMDVRMPVLDGIEATRLLAGAGVPHPVKVLVVTTFNLDKYVYEALRAGAS
FT                   GFLLKEAPPSQLLHGIRTVATGAALLDPEVTRRLVGTYVARIRPAEDTSRDIPLTPREL
FT                   EVLRLIADGFSNSEIAAALQISPETVKTFVSRILTKLDLRDRVQAVVYAYRQGLVT"
     atgaccgcgc cgatccgggt cctggtctgc gatgaccaag tgctggtccg caccggactg        60
     gtgacgatca tcgacgccca gcccgacctc gaggtggtcg gcgaatgcga agacgggcaa       120
     gccgcggtcg acctggccgg tcggctgcgc ccggaggtcg tggtgatgga cgtacgcatg       180
     ccggtgctcg acggtatcga ggccacccgc ctgctggccg gcgccggggt gccgcatccc       240
     gtcaaggtgc tcgtggtgac gacgttcaac ctggacaagt acgtgtacga ggcgttgcgc       300
     gcgggggcga gcggattcct gctcaaggaa gccccgccgt cccaactgct gcacgggatc       360
     cggaccgtgg ccaccggcgc ggcgctgctg gaccccgagg tgacgcgccg gctcgtgggc       420
     acgtacgtcg cccggatccg gcccgccgag gacacctcgc gtgatatccc gctgaccccg       480
     cgcgaactgg aggtccttcg cctcatcgcg gatggcttct ccaacagtga gatcgccgcg       540
     gccctccaga taagcccgga gaccgtgaaa actttcgtgt cgcgcatcct caccaaactc       600
     gatctccgcg accgcgtcca ggcggttgtc tatgcctacc gccaaggcct ggtgacctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page