(data stored in ACNUC7421 zone)

EMBL: CP002047.PE41

CP002047.PE41        Location/Qualifiers
FT   CDS_pept        37318..38274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00041"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /note="COG4977 Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03162"
FT                   /db_xref="GOA:D7BSY5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY5"
FT                   /protein_id="ADI03162.1"
FT                   /translation="MPSSRLRRVAVLVLEGAKPLDVGIPAQVFTTRASMPYEVRVCGAA
FT                   PGLVTGGDGLAYHVTHGLDALGWADIVFVPGYRFPDRDDPPRAVVDALIAAHDRGARLA
FT                   AISTGAFALAATGRLDGKRATTHWHYTRALAQKHPLIRVDENVLFVDEGSVLTSAGAAS
FT                   GIDLCLHILRGDLGVAASNHAARRLVAAPYRSGGQAQYVPRSVPEPLGERFAATREWAL
FT                   HRLDEPLSLESLAQHAAVSPRTFSRRFVEDTGYTPMQWVMRARIDLARELLERSKRSVE
FT                   QIANDVGLGTGANLRMHFQHILGTTPSEYRRTFTRGE"
     gtgccgtcct cccgcctgcg ccgagtcgcc gtcctcgtac tcgagggtgc gaagccgctc        60
     gatgtcggca tccccgcaca ggtgttcacg acccgtgcca gcatgccgta cgaggtgcgg       120
     gtgtgcggcg cggcgcccgg gctcgtgacc ggcggcgacg gcctggccta ccacgtcacc       180
     cacggtctcg acgcgcttgg gtgggccgac attgtcttcg tccccggcta tcggttcccg       240
     gaccgcgacg acccgccacg ggccgtcgtc gacgcgctga tcgccgcaca cgaccgaggt       300
     gcacggcttg ccgccatctc gacgggcgcc ttcgcgctcg ccgccacggg ccggctcgac       360
     ggcaagcgcg ccacgacgca ctggcactac acgcgggcgc ttgcacagaa gcatccgctc       420
     atccgggtcg acgaaaacgt cctgttcgtc gacgagggca gcgtgctgac atcggccggc       480
     gccgcctcgg gcatcgacct gtgcctgcac atcctgcgcg gcgacctcgg ggtggccgcg       540
     tcgaaccacg cggcccggcg cctggtcgcg gccccctacc gcagcggcgg ccaggcgcag       600
     tacgtgccgc gcagcgtgcc cgagccgctc ggtgaacggt tcgccgccac ccgcgaatgg       660
     gccctgcacc ggctcgacga acccctcagc ctcgaatccc tcgcccagca tgcggcggtc       720
     tcaccgcgca cgttctcgcg gcgcttcgtc gaggacaccg ggtacacgcc gatgcagtgg       780
     gtcatgcgcg cccgcatcga cctggcccgt gaactgctcg agcgttcaaa acgcagtgtc       840
     gagcagatcg cgaacgacgt cggtctcggc accggcgcaa atctgcggat gcacttccag       900
     cacatcctcg gcaccacccc cagcgagtat cgacgtacct tcacccgggg cgagtag          957
//

If you have problems or comments...

PBIL Back to PBIL home page