(data stored in ACNUC7421 zone)

EMBL: CP002047.PE410

CP002047.PE410       Location/Qualifiers
FT   CDS_pept        complement(483271..484401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00410"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="COG3851 Signal transduction histidine kinase,
FT                   glucose-6-phosphate specific"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03531"
FT                   /db_xref="GOA:D7BYK3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK3"
FT                   /protein_id="ADI03531.1"
FT                   /translation="MDVTVRDLPLGLLILAASLLPASQNHGTQLGGLTARPFDALAIVA
FT                   VALQCLPLALRRRWPVVCLSLVSLGFAVDQLRGYHSLAGTAMPIALLTAGSHLERHRRA
FT                   TVFLFSAAYVPLAVALYQLGSGEPPSEFVMYYVALALAWGIGGWLRSTRAAEAERRRRV
FT                   AEDTRTAERARIARELHDVVTHHVTAMVVQAEAARYLTAAPDRLDQALTAVTDAGRRAT
FT                   ADLRHLLDLINPDHGSGPARTPPVGRLLTLVEQTRRAGQPVEFTEEGTPAESTGSADLV
FT                   AYRVVQEALTNALKYAHGIRTSVQVHHGEKGITVEVSTDGSGSPAGSRTGSLGGSGRGL
FT                   AGLRERVDVLGGDFSAGARTGGGFVVRARIPAGSPS"
     ttggatgtca cggtccggga tctcccgctc ggcctgctga tcctcgccgc gtcgctcctg        60
     ccggcgtccc agaaccacgg gacacagctc ggcggcctta cggcccgccc cttcgacgcg       120
     ctggccatcg tggcagtcgc cctccaatgc ctgccgctcg ccctgcgccg gcggtggccg       180
     gtcgtctgtc tctccctggt gtcgctcggc ttcgccgtcg accagctccg tggctaccac       240
     tcgctcgcgg ggaccgcgat gcccatcgcg ctgctgaccg cggggtccca tctggagcgg       300
     caccggcgcg ccaccgtgtt cctcttctcc gcggcgtacg tgccactggc ggtcgccctc       360
     taccagctcg gttcgggcga gccgccgagc gagttcgtga tgtactacgt ggccctggcc       420
     ctcgcgtggg gcatcggggg gtggctgcgc tcgacccggg ccgcggaggc cgaacgccgc       480
     cgccgcgtcg ccgaggacac ccgcaccgcc gaacgcgccc gtatcgcccg cgagctgcac       540
     gacgtagtga cccaccatgt gacggcgatg gtcgtacagg ccgaggcggc ccgctatctg       600
     accgccgcgc ccgatcgcct cgaccaggcc ctgaccgcgg tcaccgatgc cggccggcgg       660
     gccaccgccg atctgcggca tctgctcgac ctgatcaacc ccgaccacgg ctccggaccg       720
     gccaggacgc cgcccgtcgg caggctgctc acgctcgtgg agcagacgcg ccgggccggg       780
     cagccggtgg agttcacgga ggagggcacg cccgcggagt cgaccggcag tgccgacctc       840
     gtggcatacc gagtcgttca ggaggctctg acgaacgccc tcaagtacgc ccacggcatc       900
     cgtacctcgg tccaggtgca ccacggcgag aaaggcatca ccgtggaggt cagcacagac       960
     ggctccggtt cgccggccgg ctcgaggacc ggctccctcg gcgggagtgg ccggggcctc      1020
     gccggtctgc gcgaacgggt cgacgtcctg ggcggcgact tcagcgcggg cgcccggacg      1080
     ggcggcggct tcgtcgtccg ggcccggatc cccgcgggga gtccgtcatg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page