(data stored in ACNUC7421 zone)

EMBL: CP002047.PE411

CP002047.PE411       Location/Qualifiers
FT   CDS_pept        complement(484437..485273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00411"
FT                   /product="Abortive infection protein"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03532"
FT                   /db_xref="GOA:D7BYK4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK4"
FT                   /protein_id="ADI03532.1"
FT                   /translation="MRLVWQLVAVGAVAFLGGQGIAAVEGNPWLKLAIGVPTAVLAVFV
FT                   YGWVVRRTERRPSTEVAREGAGAAIGWGVLIGFVMSGFVIANIAFLGYYTVNGLGSPTG
FT                   AVGLFGFMAAAAVTEELMYRGVLFRIAEERMGTWIALALTGVLFGLSHLLNPNASLWGA
FT                   IAIAIEAGGMLGAAYAATRNLWVPIGLHFGWNFAISAIFSTEVSGNGTAKGLLDSATSG
FT                   PAPITGGDFGPEGSLYTVLFGVLVTIVFMWLARRRGHLMPRRRRAVEVAATATLAR"
     atgaggctgg tttggcaact ggtggccgtc ggggcggtcg ccttcctcgg cggccagggc        60
     attgccgcgg tggaggggaa cccgtggctc aagctggcca tcggagtccc gacggccgtg       120
     ctcgcggtgt tcgtctacgg gtgggtggtg cggcggaccg agcgccgccc gtccacagag       180
     gtggcccggg agggtgccgg ggccgcgatc ggctgggggg tgctgatcgg cttcgtgatg       240
     tccgggttcg tgatcgcgaa tatcgccttc ctcgggtact acacggtcaa cggcctgggc       300
     tcgccgacgg gcgcggtggg gctgttcggc ttcatggccg ccgctgccgt gacggaggaa       360
     ctgatgtacc gcggcgtcct gttcaggatt gccgaggagc gcatgggcac atggatcgcg       420
     ctggcgctga ccggggtgct gttcgggctg tcgcatctgc tcaacccgaa cgccagcctg       480
     tggggcgcca tcgccatcgc gatcgaggcc ggtggcatgc tcggcgccgc gtacgccgcc       540
     acccgcaacc tgtgggtgcc gatagggctg cacttcggtt ggaacttcgc catctccgcc       600
     atcttcagca ccgaggtgtc gggcaacggc accgcgaagg gactgctgga ctccgcgaca       660
     tcgggcccgg cgccgatcac cggtggcgac ttcggtccgg agggaagtct gtacacggtg       720
     ctgttcggtg tgctggtgac gatcgtgttc atgtggctgg cccgccggcg cggccatctg       780
     atgcctcgcc gtcggcgggc cgtcgaggtt gccgccaccg ctacactcgc ccggtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page