(data stored in ACNUC7421 zone)

EMBL: CP002047.PE413

CP002047.PE413       Location/Qualifiers
FT   CDS_pept        486541..487143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00413"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03534"
FT                   /db_xref="GOA:D7BYK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK6"
FT                   /protein_id="ADI03534.1"
FT                   /translation="MKTQRESTPARSRPLRADAERTVTAILEAAERTLSRDPAATMEQI
FT                   AEAAGVARTTVHRRFATREALIDALAGWATERFAAAVDAAHPDTAPPLVALYQTTANVL
FT                   GVKVSWGFAMSQASSVNPEVARVHSGVRDTCERLFRRAQEAGVLRADIDIPWTRRVYYA
FT                   LIHEAAQNRNEQDTATLATLVVDTLLRGAGTPHPDRL"
     atgaagacgc agagggagtc gacccccgcc cgcagccgac cgctgcgcgc ggacgccgag        60
     cggacggtga cggcgatcct ggaggcggcc gagcgcaccc tcagccgcga ccccgcggcc       120
     acgatggagc agatcgccga agccgccggt gtcgcccgca ccaccgtgca ccggcgcttc       180
     gccacccggg aggcgctgat cgacgccttg gcggggtggg ccaccgagcg gttcgccgcg       240
     gcggtcgacg ccgctcaccc ggacacggct ccgccgctgg tcgctctcta ccagacgacc       300
     gcgaacgtgc tcggcgtcaa ggtcagctgg ggattcgcga tgagccaggc atcctcggtc       360
     aacccggagg tggcgcgtgt ccacagcggt gtacgggaca cctgcgagcg gttgttccgc       420
     cgggcccagg aggcaggcgt cctgcgcgcc gacatcgaca ttccgtggac ccgccgcgtc       480
     tactacgccc tcatccacga ggccgcgcag aacaggaacg agcaggacac cgccaccctc       540
     gccacgctcg tcgtggacac cctgctccgc ggcgcgggca ccccgcaccc cgaccggctg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page