(data stored in ACNUC7421 zone)

EMBL: CP002047.PE414

CP002047.PE414       Location/Qualifiers
FT   CDS_pept        complement(487171..488910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00414"
FT                   /product="hypothetical protein"
FT                   /note="COG1626 Neutral trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03535"
FT                   /db_xref="GOA:D7BYK7"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK7"
FT                   /protein_id="ADI03535.1"
FT                   /translation="MTAARPGPAFSLHDIPFSAYGSWFGISPVLAEQTHAEDLHLVSHQ
FT                   NGMHAVLRLVPLDPTTGGRADTRVTATPSLLSWRNDHGRIDLAYESPDTVRLRGKGTAL
FT                   RVSAAAPTLTPFTGTYFFRDPAAGAYVFTSYETGRRYRLTVLSGAVRDASGGQALGSAD
FT                   RGLTITADHGHGGTWEAAIEEFDSGRRPYSSARATFDEVVAAAERAFADFADTVAPWRS
FT                   SRTPAAELAAYVLWSATVAPAGLVTRPAVLMSKHWMDKVWSWDHCFNALALAPGAPALA
FT                   WDQFSLPFDHQDESGALPDSVTHSEVLYNFVKPPIHGWTLAHLRRRLPEPLGHAELTAT
FT                   YDRLRRWTDFWLTARRAPGATLPHYQHGNDSGWDNATTFDPERVVATADLAAFLLLQLR
FT                   ELAALATELGHTDEARGWTRTAETIQTAMLDQLWSGERFLARGADSGDTWSSASLLDLM
FT                   PITLGEHLPENIAKTLATRIEAHLTPYGLATELPTSPHYRPDGYWRGPIWAPATVLIED
FT                   GLRRSGHQRLADEISARFRLLCETHGFAENFDALTGTGLRDRAYTWTAAAYLLLAEGHA
FT                   LRN"
     atgaccgccg cccggcccgg cccggccttc tccctccacg acatcccgtt cagcgcgtac        60
     ggatcctggt tcggcatctc cccggtgctg gcggagcaaa cgcacgccga agacctccac       120
     ctggtctccc atcagaacgg catgcacgcc gtcctgcgcc tcgtccccct cgaccccacg       180
     acgggcggcc gggccgatac ccgcgtcacg gcgacaccaa gtctcctcag ctggcgcaac       240
     gatcacgggc ggatcgacct cgcgtacgag tcgccggaca ccgtgcgtct gcgggggaag       300
     ggcaccgccc tgcgcgtcag cgcggcagcg ccgaccctca cgcccttcac cggtacgtac       360
     ttcttccgcg acccggcggc cggagcgtac gtgttcacct cgtacgagac cgggcgccgc       420
     taccggctca ccgtgctgtc gggggccgta cgggacgcct ccggcggcca ggccctgggc       480
     agcgccgacc gtggactgac gatcacggcg gaccacggtc acggcggaac ctgggaggcc       540
     gccatcgagg agttcgacag cgggcgccgc ccctacagca gcgcccgtgc gacgttcgac       600
     gaagtcgtgg ccgcggcgga gcgggccttc gccgacttcg ccgacaccgt ggccccctgg       660
     cgctcctccc gtacccccgc cgccgaactc gccgcgtacg tcctgtggtc ggcgacggtc       720
     gccccggccg gcctcgtcac ccggcccgcg gtgctgatgt cgaagcactg gatggacaag       780
     gtctggagct gggaccactg cttcaacgcc ctggccctgg cgcccggagc gcccgcgctg       840
     gcctgggacc agttctcgct gccgttcgac caccaggacg agagcggggc gctgcccgac       900
     tcggtgaccc actcggaagt gctctacaac ttcgtcaaac cacccatcca cggctggacc       960
     ctggcccatc tgcgccgacg gctccccgaa cccctcggcc acgccgaact caccgcgacg      1020
     tacgacagac tgcggcgctg gacggacttc tggctcaccg cgcgccgcgc cccgggcgcc      1080
     actctgcccc actaccagca cggcaacgac agcggctggg acaacgcaac caccttcgac      1140
     cccgagcggg tggtcgccac cgccgacctg gccgcgttcc tgctgctgca actgcgcgaa      1200
     ctcgcggccc tggcaacgga actcggccac accgacgagg cccgcggctg gacgcgcacc      1260
     gcggagacga tccagacagc catgctcgac cagctctggt cgggggagcg gttcctcgcc      1320
     cgcggcgccg acagcggcga cacctggagc agtgccagcc tcctcgacct catgccgatc      1380
     accctgggcg aacacctccc cgagaacatc gccaaaacgc tggccacccg gatcgaggcc      1440
     cacctcaccc cgtacggcct ggccaccgaa ctgcccacct caccgcacta ccgcccggac      1500
     ggctactggc gcggcccgat ctgggcgccc gccaccgtcc tcatcgagga cggcctgcgc      1560
     cgcagcggcc accaacgcct cgccgacgag atcagcgccc gcttccggct cctgtgcgaa      1620
     acccacggct tcgccgagaa cttcgacgcc ctcaccggca cgggcctgcg cgaccgcgcc      1680
     tacacctgga ccgccgccgc ctatctcctg ctcgccgaag gccacgcact ccggaactga      1740
//

If you have problems or comments...

PBIL Back to PBIL home page