(data stored in ACNUC7421 zone)

EMBL: CP002047.PE415

CP002047.PE415       Location/Qualifiers
FT   CDS_pept        complement(488979..489824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00415"
FT                   /product="putative integral membrane transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03536"
FT                   /db_xref="GOA:D7BYK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK8"
FT                   /protein_id="ADI03536.1"
FT                   /translation="MSTATTPRRHPGRTTWWKTATGLVLTGIMLFPVYWMLNASFTRDQ
FT                   DMRKSPPDLFPVHGTLEGYRAVLDQQLPYLGTSLVIGAGTVVLTVALAAPAGYALATLR
FT                   PRGGGLVSFLFLVAQMIPGIIMAMGFYAIYLSLGLLQSVPGLIVADSTLAVPFAVLIFT
FT                   AFMSGIPRELLQAAKTDGAGPFRTFWSIALPMSRNAVVTVSLFAFLWSWSDFVFAGTLV
FT                   NGGAHEPITLGIYHYIGNNNQEWNAIMATAVVASLPAAVILVLAQRYVAAGVAAGAVKD
FT                   "
     atgagcaccg ccaccacacc ccgccgccac ccgggccgta ccacctggtg gaagacggcc        60
     accggcctcg tactcaccgg gatcatgctc ttcccggtgt actggatgct caacgcgtcc       120
     ttcacccgcg atcaggacat gcgcaagagc ccgcccgatc tgttccccgt acacggcacc       180
     ctggagggct accgggccgt cctggaccag caacttccct atctcgggac cagcttggtg       240
     atcggtgccg ggacggtcgt gctgaccgtg gcgctcgccg ctccggccgg ctacgcactc       300
     gccacactgc gtccacgggg cggcggtctg gtcagcttcc tcttcctggt cgcccagatg       360
     atccccggca tcatcatggc gatgggcttc tacgccatct acctcagcct cggactgctc       420
     cagtcggtgc ccggcctgat cgtcgcggac tccacgctgg ccgtcccgtt cgcggtgctg       480
     atcttcaccg cgttcatgtc cgggatcccg cgcgaactgc tccaggccgc caagaccgac       540
     ggagccggcc ccttccgcac cttctggtcg atcgcgctgc ccatgagccg caacgccgtc       600
     gtcaccgtgt cgctgttcgc gttcctgtgg tcctggtccg acttcgtctt cgccggcacc       660
     ctcgtgaacg gcggcgcaca cgagccgatc accctcggca tctaccacta catcggcaac       720
     aacaaccagg agtggaacgc catcatggcc accgccgtcg tggcctcgtt gcccgcggcg       780
     gtgatcctcg tcctcgccca gcgctatgtc gccgccgggg tggccgccgg agccgtgaag       840
     gactga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page