(data stored in ACNUC7421 zone)

EMBL: CP002047.PE416

CP002047.PE416       Location/Qualifiers
FT   CDS_pept        complement(489821..490801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00416"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03537"
FT                   /db_xref="GOA:D7BYK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK9"
FT                   /protein_id="ADI03537.1"
FT                   /translation="MNRTAHLPDRPPALDRNGPATAKLPARTAPRRRPRSQQWAAWAFL
FT                   TPVTLYLVLFYAYPLYRNLDLSLRHYTVRSFVQGDAPFTGLANYRTVFDDPTFGPALIH
FT                   TVMFTAVCLFFQYAIGLALAVFFNQHFRLSVTLRALFLVPWLLPLIVSASTWSWMLNSD
FT                   SGVVNAALHIVGIGPVNWLTSPSWSLTSVIIANIWIGVPFNLVVLHSGLQSIPASLYEA
FT                   AALDGAGAWRRFWHITFPLLRPVSAITLLLGLVYTLKVFDIIWIMTKGGPADSSTTFAT
FT                   WSYQLGFGNLLPAFGPGAAVGNLLVLAALVFGLVYLRVQRKQYAS"
     atgaaccgca cggcacacct cccggaccgc ccgcccgcgc tcgaccggaa cgggccggcc        60
     accgccaagc tcccggcccg caccgcgcca cggcgccgcc cccgctcgca gcagtgggcc       120
     gcctgggcct tcctcacccc ggtcaccctc tacctcgtcc tcttctacgc ctatccgctg       180
     tatcgcaacc tcgatctgag tctgcgccac tacaccgtcc gctccttcgt ccagggcgac       240
     gcgcccttca ccggcctggc caactaccgg accgtcttcg acgatccgac cttcggcccg       300
     gcgctcatcc acaccgtgat gttcaccgcc gtgtgcctgt tcttccagta cgccatcggc       360
     ctggccctcg ccgtattctt caaccagcac ttccggctct ccgtcaccct gcgcgccctg       420
     ttcctggtgc cctggctgct gccgctgatc gtgtcggcct ccacctggtc atggatgctg       480
     aacagcgact ccggcgtcgt caacgccgcc ctgcacatcg tcggcatcgg cccggtgaac       540
     tggctgacgt cgccgtcgtg gtcgctgacc tcggtgatca tcgcgaacat ctggatcggt       600
     gtccccttca acctggtcgt gctccacagc ggcctccagt cgatccccgc cagcctgtac       660
     gaggcggccg ccctcgacgg cgcgggggcc tggcgccgct tctggcacat cacctttccg       720
     ctgctgcgcc ccgtgtccgc catcaccctg ctgctgggcc tggtctacac gctcaaggtc       780
     ttcgacatca tctggatcat gaccaagggc ggcccggccg actcgtccac caccttcgcc       840
     acctggtcct accagctcgg cttcggcaat ctgctccccg ccttcggccc cggagcggcc       900
     gtcggcaacc tcctcgtcct cgccgccctg gtcttcggcc tggtgtatct gagggtccag       960
     cgaaagcagt acgcctcatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page