(data stored in ACNUC7421 zone)

EMBL: CP002047.PE417

CP002047.PE417       Location/Qualifiers
FT   CDS_pept        complement(490815..492053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00417"
FT                   /product="putative sugar binding protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03538"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL0"
FT                   /protein_id="ADI03538.1"
FT                   /translation="MNTTSGRRLTAAALTVVALATATTACSSGGSTSAKSDDGTYTVWD
FT                   PYPQFAKDSAWVKLLDGCGSKAGVKIKRTAFDTSDLTNKALLAAQQDNSPDVLIVDNPV
FT                   VSTLAEAGVLTTTDDNKVDTSKVEPNLLAAGQSDGKTYGTPIGANTLALYYNKDVLKAA
FT                   GVDIAAIKDWPSLTAALDKVKKAGKKGITFSAIGTEEGSFQFLPWFWGSGAKLTRLDSQ
FT                   QGVSALSLWTGWLKKGYAPNSVINNTQTTSWQEFASGDYAFAENGTWQLANAEKAGFDY
FT                   GVLPIPGASGGNAAAPTGGEFVTVPVQGDTGRYATAQKLVSCLTSADNLYNTDTTLSYV
FT                   APTSVVRDKQVAADAKLKPWAEAVTSARGRTSGDLGTKYPKISEQLWKAVQSALSGAKS
FT                   PQDALATAQSAVK"
     atgaacacaa cctccggacg acggctcacc gccgcggccc tgaccgtcgt agccctcgcc        60
     accgccacca ccgcatgctc gtccggcggc agcacatccg ccaagagcga cgacggcacc       120
     tacaccgtct gggaccccta cccgcagttc gccaaggact cggcgtgggt gaagctgctg       180
     gacggctgcg gcagcaaggc gggcgtgaag atcaagcgga ccgccttcga cacgagcgac       240
     ctgacgaaca aggcgcttct ggcggcccag caggacaact ccccggacgt gctcatcgtc       300
     gacaaccccg tggtgtcgac cctggcggag gccggagtgc tgaccaccac cgacgacaac       360
     aaggtggaca cctcgaaggt cgagcccaac ctgctcgcgg ccggccagtc ggacggcaag       420
     acctacggaa cccccatcgg cgccaacacc ctcgccctct actacaacaa ggacgtcctc       480
     aaggccgcgg gcgtcgacat cgcagcgatc aaggactggc cgtcgctgac ggcggccctg       540
     gacaaggtca agaaggcggg caagaagggc atcaccttct ccgcgatcgg cacggaggag       600
     ggcagtttcc agttcctgcc gtggttctgg ggctcgggcg cgaagctgac ccgactcgac       660
     tcccagcagg gcgtttcggc cctgtccctg tggaccggct ggctgaagaa gggctacgcc       720
     cccaactcgg tgatcaataa cacccagacc accagctggc aggagttcgc gagcggcgac       780
     tacgccttcg ccgagaacgg cacctggcag ctggccaacg ccgagaaggc cggtttcgac       840
     tacggcgtgc tcccgatacc cggcgcctcg ggcggcaacg ccgcggcccc gaccggcggc       900
     gagttcgtca ccgttccggt ccagggcgac accggccgct acgccaccgc ccagaagctg       960
     gtttcctgcc tgaccagcgc cgacaacctc tacaacacgg acaccaccct gtcctatgtg      1020
     gcccccacca gcgtggtgcg cgacaagcag gtggcggccg atgccaagct caagccctgg      1080
     gccgaggcgg tcacctcggc caggggacgc accagcggcg acctcggcac caagtacccc      1140
     aagatttcag agcagttgtg gaaggccgtg cagtccgccc tcagcggggc caagtccccc      1200
     caggacgcgc tcgccacggc ccagagcgcg gtcaagtag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page