(data stored in ACNUC7421 zone)

EMBL: CP002047.PE423

CP002047.PE423       Location/Qualifiers
FT   CDS_pept        complement(500463..501116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00423"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03544"
FT                   /db_xref="GOA:D7BYL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL6"
FT                   /protein_id="ADI03544.1"
FT                   /translation="MADRARRGEQVSATRVALLDAAERLFAERGVHAVANRQISEAAGQ
FT                   GNNAAVSYHFGTKVDLVRAIARRHAERVEVGRVRMLDAIGESADLRDWVACAVRPVTEH
FT                   LEALGAPSWYARFIAQVSADPALRAVTVEEFAAGSPSMRRLQEGLEGCLPDLPAEVHAE
FT                   RAAMTRHLIAQMSAERERALADNAPTARASWQGTANGLIDAIVALWRAPFTREG"
     atggccgaca gggcgagacg gggcgagcag gtcagtgcga cgcgggtggc gctcctggac        60
     gcggcggagc ggctgttcgc cgagcgcggg gtgcatgcgg tcgccaaccg tcagatcagc       120
     gaggccgccg ggcagggcaa caatgccgcg gtcagctatc acttcggcac caaggtcgat       180
     ctggtgcgtg ccatcgcccg tcggcatgcg gagcgggtgg aggtcggccg tgtgcgcatg       240
     ctggacgcga tcggggagtc cgctgatctg cgggactggg tggcctgtgc ggtccgtccg       300
     gtgaccgagc acttggaggc tctgggtgcg cccagctggt atgcgcggtt catcgcccag       360
     gtgtcggcgg atccggcgct gcgtgccgtc acagtggagg agttcgcggc cgggtcgccg       420
     tcaatgcggc ggttgcagga ggggctggag ggctgtctgc ccgatctgcc ggccgaggtg       480
     catgccgaac gtgcggccat gacgcgtcac ttgatcgcgc agatgtccgc ggagcgggag       540
     cgtgccctcg cagacaacgc gccgactgcc cgggccagtt ggcaggggac ggcgaacgga       600
     ctgatcgatg ccatcgtcgc cctgtggcgg gcgccgttca cacgcgaggg ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page