(data stored in ACNUC7421 zone)

EMBL: CP002047.PE426

CP002047.PE426       Location/Qualifiers
FT   CDS_pept        complement(503098..504111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00426"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03547"
FT                   /db_xref="GOA:D7BYL9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL9"
FT                   /protein_id="ADI03547.1"
FT                   /translation="MPTPLPFIAVTMGDGAGIGPEVVVAALLDDAVLTRCRPVVIGDAQ
FT                   RLREAARILGLDCEIAAVDHPRDAEFTPGRVNVVDLGLLPADLPWGELSPVAGGAAYAY
FT                   IERAAALAVAGEVHAICTAPLNKEALHAAGHIYPGHTELLAHLTGTEEVSMMLSTEKVK
FT                   VIHVTTHIGLIDAVNRIEPGLVERTVRRGHQAMVRAGTPNPVIGVCGINPHAGENGLFG
FT                   YGEEEEKIVPALEVLRAEGVDARGPLPADTAFFLAGRGDYDLIVAMYHDQGHGPVKVLG
FT                   IEAGVNLTVGLPVIRTSVDHGTAFDIAGTGTAEAGSMVEALRQATEMATVPVTPAA"
     atgcccaccc ccctcccctt catcgccgtc accatgggcg acggtgccgg tatcggcccc        60
     gaggtcgtcg tcgcggccct cctcgacgac gccgttctga cccgctgccg ccccgtcgtc       120
     atcggcgacg cacagcggct gcgcgaggcc gcccgcatcc tcggcctgga ctgcgagatc       180
     gccgcggtcg accacccccg cgacgccgag ttcacccccg gccgcgtcaa cgtcgtcgac       240
     ctcggcctgc tccccgccga cctgccctgg ggcgagctgt cgccggtcgc gggcggcgcc       300
     gcgtacgcgt atatcgagcg ggccgccgca ctcgccgtgg cgggcgaggt gcacgccatc       360
     tgcaccgcgc cgctcaataa ggaggccctg cacgccgcgg gccacatcta ccccggccac       420
     accgaactcc tcgcccatct gaccgggacc gaagaggtct cgatgatgct ctccaccgag       480
     aaggtgaagg tcatccacgt caccacgcat atcggcctga tcgatgcggt caaccgcatc       540
     gagccgggcc tcgtcgagcg caccgtacgc cgcggccacc aggcgatggt ccgcgccggc       600
     accccgaacc ccgtgatcgg cgtctgcggt atcaacccgc acgcgggcga gaacgggctg       660
     ttcggctacg gcgaggaaga ggagaagatc gtcccggccc tggaggtgct gcgcgccgag       720
     ggcgtcgacg cccggggccc gctccccgcc gacaccgcct tcttcctggc cggccgcggc       780
     gactacgacc tgatcgtggc gatgtaccac gaccagggcc atggccccgt caaggtcctg       840
     ggcatcgagg cgggcgtcaa cctcaccgtg ggcctgcccg tcatccgtac gtccgtcgac       900
     cacggcaccg cgttcgacat cgccggaacg ggcacggcgg aggccggcag catggtcgag       960
     gcgctgcgcc aggcgaccga gatggccacg gtgccggtca ccccggcggc ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page