(data stored in ACNUC7421 zone)

EMBL: CP002047.PE43

CP002047.PE43        Location/Qualifiers
FT   CDS_pept        complement(40109..41536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03164"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY7"
FT                   /protein_id="ADI03164.1"
FT                   /translation="MATFTYTNLLTMDLGKLGTAVTDWKTMVGNLAKLKTEVSRGLVAK
FT                   SEAARWEGVNATVTREFVRSTAKEFGDLHLEAESIHNVLQDAHTELSAVQKRAKQLDEE
FT                   ARKGGKVDPGMSVSDNGNGTVTVRALCSKKFPLYSQRSKDLEQWYADTLTGLVAHASEI
FT                   DAAVSRALKNSHGGEPLNPGHAKYTSLDEDQLPRAVKLAALGGDANPRQRAELGRLWQS
FT                   LSPEARAQLWKEHKKDLLAAGLLETTIKRLSPDAGSGPHGAETPGMTEVMTGAKMQLLA
FT                   ERADALGMTDAGRHMAHYLSNSGSPMFLPVDKMLSDDKGFQAHIEKQIRDNQNEWRKKA
FT                   LAEFWRNGGRPVAIPVQTGNRGYTFDREKNPNWFFAVGSTGSNVTGVVTVEPDASGKPK
FT                   VGLDYQTNAWDRYNWDKGKGVDIGKIHIPDGQPSRLHTTGLAQEFSVSGSSSVKHYDLG
FT                   GSTPNNGPLPKPDEPWR"
     gtggcgacct tcacatacac caacctcctc acgatggacc tcggcaagct gggcaccgcg        60
     gtcaccgact ggaagaccat ggtcggcaac ctggcgaagc tcaagaccga ggtctccagg       120
     ggactggtgg cgaaatccga ggcggcacgg tgggaggggg tgaacgccac cgtcacccgg       180
     gagttcgtac gcagcacggc aaaggagttc ggcgatctgc acctggaggc cgagtccatc       240
     cacaacgtgc tccaggacgc ccacaccgag ctgtcggcgg tccagaagcg ggcgaagcag       300
     ctcgacgagg aggcgcgcaa gggcggcaaa gtggaccccg gcatgtccgt gtcggacaac       360
     ggcaacggca cggtgaccgt gcgcgcgctg tgctccaaga aattcccgct ctattcgcag       420
     cggagcaagg acctggagca gtggtacgcg gacaccctca ccgggctggt cgcccacgcc       480
     tcggagatcg acgccgccgt ctctcgcgcc ctgaagaaca gccacggtgg cgaacccttg       540
     aaccccggcc acgccaagta cacctcgctg gacgaggacc agttgccgcg agccgtgaag       600
     ctggccgcgc tcggcggcga cgcgaacccg aggcagcgcg ccgaactggg tcgcctgtgg       660
     cagtcgctga gtccggaggc gcgtgctcag ctgtggaagg agcacaagaa ggacctgctg       720
     gcggcgggtc tgctggaaac cacgatcaag cgactctccc cggacgccgg ttcgggtccg       780
     cacggtgcgg agactcccgg catgacggag gtgatgaccg gggcgaagat gcagctgctg       840
     gccgagaggg ccgacgcgtt gggcatgacc gacgcgggcc gccacatggc gcactacctc       900
     agcaactccg gcagccccat gttcctgcct gtcgacaaga tgctgtccga cgacaaaggg       960
     ttccaggccc acatcgaaaa acagatcagg gacaaccaga acgagtggcg caagaaggcg      1020
     ctcgcggagt tctggaggaa cggcggcagg ccggtcgcca tcccggtgca gaccgggaac      1080
     aggggctaca ccttcgaccg ggagaagaac cccaactggt tcttcgccgt cggatccacc      1140
     ggctcgaacg tgactggcgt ggtcacagtg gagccggacg ccagcggcaa gcccaaggtc      1200
     ggcctcgact accagaccaa cgcctgggac cgctacaact gggacaaggg caagggcgtg      1260
     gacatcggca agatccacat cccggacgga cagccgtcgc ggctgcacac gacaggtctc      1320
     gcccaggagt tcagcgtgtc ggggtccagt tcggtcaaac actacgacct gggtggatcc      1380
     acaccgaaca acggcccgct cccgaaaccc gacgagccgt ggcgctag                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page