(data stored in ACNUC7421 zone)

EMBL: CP002047.PE434

CP002047.PE434       Location/Qualifiers
FT   CDS_pept        complement(512059..513324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00434"
FT                   /product="hypothetical protein"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03555"
FT                   /db_xref="GOA:D7BYM7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYM7"
FT                   /protein_id="ADI03555.1"
FT                   /translation="MTSLSPHLRQATPVTAERGEGVYLYGTDGRRYLDFTAGIGVTSTG
FT                   HCHPRVVAAAQEQIGKLIHGQYTTVMHQPLQRLVERLGDVLPAGLDSLFFSNSGSEAVE
FT                   AALRLARQATGRPNVVVFHGGFHGRTVAAATMTTSGTRFRTGFSPLMSGVAVAPFPTAF
FT                   RYGWDQETATRFALTELDYLLQTVTAPQDTAAFVVEPVLGEGGYIPADPAFLRGLRERA
FT                   DRHGIVLVVDEIQTGFGRTGRYWGHDHADDVRPDIITIAKGLASGFPLSGIAASQELMS
FT                   KAYPGSQGGTYGGNAVACAAAVATLDVIRDEKLVENADAMGRRLRAGLEEVARTTPGIA
FT                   DVRGLGLMLAGEFVTADGSPDPDTAARVQQAAAAEGLLLLLCGPWNSVVRMIPALVIDE
FT                   TAVDEGLRAWRAAVEAGTAATS"
     atgaccagcc tgtccccgca tctgcgccaa gccacccccg tcaccgccga acgcggcgaa        60
     ggcgtctatc tctacggcac cgacggccgc cgctacctcg acttcaccgc aggtatcggc       120
     gtcaccagca cgggacactg ccacccgcgc gtcgtcgccg cggcgcagga gcagataggc       180
     aagctcatcc acggccagta cacgaccgtg atgcaccagc cgctgcagcg gctggtcgaa       240
     cggctcgggg atgtgctgcc cgccggcctg gacagcctgt tcttctccaa ctccggcagt       300
     gaggccgtcg aagcggcgct gcggctggcc cggcaggcca ccggccgccc caacgtcgtc       360
     gtcttccacg gcggtttcca cgggcgtacc gtcgcggccg ccaccatgac cacgtccggc       420
     acccgcttcc gcaccgggtt ctccccgctg atgtcgggcg tcgccgtcgc cccgttcccc       480
     accgccttcc gctacggatg ggaccaggag accgcgaccc gcttcgcgct caccgagctc       540
     gactatctgc tgcagaccgt caccgcgccc caggacaccg cggccttcgt ggtcgagccc       600
     gtgctcggcg aaggcggcta catccccgcc gacccggcct tcctgcgcgg gctgcgcgag       660
     cgcgccgacc gccatggcat cgtgctcgtg gtggacgaga tccagaccgg cttcggccgc       720
     accggccgct actggggcca cgaccacgcc gacgacgtcc gcccggacat catcaccatc       780
     gccaaggggc tggccagcgg attcccgctg tccggcatcg ccgcctcgca ggagctgatg       840
     agcaaggcgt accccggctc ccagggcggc acctacggtg gcaacgccgt cgcgtgcgcg       900
     gccgcggtcg ccaccctcga tgtgatccgg gacgagaagc tggtggagaa cgccgacgcg       960
     atgggacggc ggctgcgcgc cgggctggaa gaggtcgccc gcaccacgcc gggcatcgcg      1020
     gacgtccgcg gactgggcct gatgctggcc ggcgagttcg tcaccgccga cggttccccc      1080
     gacccggaca ccgccgcccg ggtacagcag gccgccgccg ccgaggggct gctgctgttg      1140
     ctgtgcggcc cctggaacag cgtcgtacgc atgatcccgg cgctggtcat cgacgagacc      1200
     gccgtcgacg agggactgcg cgcctggcgg gccgccgtcg aggcgggcac ggccgccacg      1260
     tcatga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page