(data stored in ACNUC7421 zone)

EMBL: CP002047.PE439

CP002047.PE439       Location/Qualifiers
FT   CDS_pept        517387..517761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN2"
FT                   /protein_id="ADI03560.1"
FT                   /translation="MPGMTDTEVILHDVLDRWKAGVDNHEPEQVASLFTEDAIFQGLRP
FT                   YSVGRRGVADYYASQPLGLSAAYRILESRRLAEDIALGYLTVDFSFTDRPTISINLLVL
FT                   LKRSEADWLISHYQVSSRLG"
     atgcccggca tgacagacac cgaagtgatc ctgcatgacg tcctcgaccg gtggaaggca        60
     ggcgtcgaca accacgagcc ggagcaggtc gcatccctct tcaccgagga cgcgatcttc       120
     caggggttgc gtccgtacag cgtgggaagg cggggcgtcg ccgactacta cgcatcccag       180
     cccctgggct tgtcagccgc ctaccgcatc ctggaaagca ggcgcctcgc cgaggacatc       240
     gcgctcggct acctgaccgt cgacttctcg ttcaccgacc ggccgacgat cagcatcaac       300
     ctgctcgtac tgctgaagcg ctcggaagcc gattggctca tcagccacta ccaggtctcc       360
     tcccgcctcg gctag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page