(data stored in ACNUC7421 zone)

EMBL: CP002047.PE44

CP002047.PE44        Location/Qualifiers
FT   CDS_pept        complement(41586..42080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03165"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY8"
FT                   /protein_id="ADI03165.1"
FT                   /translation="MVVKVTFDQEWAELVSAAKERQSAGMRLNQALPGPGPGGGANHDL
FT                   VVHQDDLGAVGHEAYELHDVLRKKADIEGAGMDKSGSGSTLQAARELSAQNMTMGNELS
FT                   TTVSVWDTQVKTVLQMCAHISNHLDYSKKAHTKDDEYLAASLRHRDGAAVSVSEISQYV
FT                   K"
     atggtggtga aggtgacgtt cgaccaggag tgggcggagc ttgtctccgc ggccaaggag        60
     cggcagtcgg ccgggatgcg gctcaaccag gccctgcccg gccccggccc gggtggcgga       120
     gccaaccacg acctggtcgt ccatcaggac gacctgggag ccgtcggcca cgaggcgtac       180
     gagctgcacg atgtgctgcg gaagaaggcc gacatcgagg gcgccggcat ggacaagagc       240
     gggtcgggtt ccactctgca ggccgccagg gagctgtccg cgcagaacat gaccatgggg       300
     aacgagctct cgaccacggt ctcggtctgg gacacgcagg tcaagacggt cctccaaatg       360
     tgtgcccaca tctcgaacca cctggactac tcgaagaagg cacatacgaa ggacgacgag       420
     tacctcgcgg catcgctgcg ccatcgcgac ggcgcagcgg tctcggtctc ggagatctcc       480
     cagtacgtga agtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page