(data stored in ACNUC7421 zone)

EMBL: CP002047.PE440

CP002047.PE440       Location/Qualifiers
FT   CDS_pept        518003..518410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00440"
FT                   /product="hypothetical protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03561"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN3"
FT                   /protein_id="ADI03561.1"
FT                   /translation="MELLKQPPTMKLPADWFTGDAYADVIHRGEEPSRVRANMVRFTPG
FT                   ARTAWHSHGLGQTLYIVEGIALIQSRGGKILEAHPGDVIWTPPGEEHWHGAAPDHFMVH
FT                   LALWETDDAIWLEHVTDAEYTGPRVTTRTRP"
     ttggaactgc tgaagcagcc cccgaccatg aagctgcccg ccgactggtt caccggcgac        60
     gcatacgccg acgtgatcca ccgcggcgag gagccctccc gggtgcgggc caacatggtc       120
     cgcttcacgc cgggcgcccg taccgcctgg cactcccacg gcctgggcca gacgctctac       180
     atcgtcgagg gcatcgccct gatccagtcc cggggcggca agatcctcga agctcacccg       240
     ggcgacgtga tctggacgcc gccgggcgag gaacactggc acggcgccgc tcccgaccac       300
     ttcatggtcc acctcgccct gtgggaaacc gacgacgcga tctggctcga gcacgtcacc       360
     gacgccgagt acaccggccc ccgggtcacc acccgcaccc gcccctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page