(data stored in ACNUC7421 zone)

EMBL: CP002047.PE444

CP002047.PE444       Location/Qualifiers
FT   CDS_pept        520454..521242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00444"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03565"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN7"
FT                   /protein_id="ADI03565.1"
FT                   /translation="MHQLTPAADTLFSSAEADGAAPRILPTAGLAALSKLNWEELYAQL
FT                   NEEGVAVTPPLLSRAQCQEIIDTFDKPGLFRSTVVMQRYQFGRGTYKYYADPATTVPLI
FT                   QTLRELLYPPMAWMANRWAPQLNERTFPTALEELLAECADNGQHRSTPLLLRYGPGDYA
FT                   CLHQDIYGDIVFPLQIAIMLNQPGEDFTGGENVFVEQRPRFQSRAIVVKPRLGQGMIFP
FT                   VRHRPVRGKNGFRRHPMRHGTNAVETGHRNTLGIIFHNAR"
     atgcaccagc tcacccccgc cgccgacacc ctgttctcct ctgccgaggc ggacggtgcg        60
     gcaccgcgca tccttcccac cgcgggcctt gcggcgctct ccaagctcaa ctgggaagag       120
     ctgtacgcgc agctgaacga ggagggcgtg gccgtcaccc cgccactcct ctcgcgcgct       180
     cagtgtcagg agatcatcga cacgttcgac aagcccggcc tgttccgctc caccgtcgtc       240
     atgcagcgct accagttcgg ccgcggcacc tacaagtact acgccgaccc ggccaccacc       300
     gtcccgctga tccagaccct gcgcgagctg ctgtatccgc cgatggcgtg gatggccaac       360
     cggtgggcgc cgcagctgaa cgaacgtacc ttccccaccg cgctggaaga actgctggcc       420
     gagtgtgcgg acaacggaca gcaccgctcg accccgctgc tcctgcggta cggccccggc       480
     gactacgcct gcctccacca ggacatctac ggcgacatcg tcttcccgct gcagatcgcc       540
     atcatgctca accagcccgg cgaggacttc accggcggcg agaacgtctt cgtcgaacaa       600
     cggccccggt tccagtcccg ggcgatcgtc gtcaagcccc ggctcggcca gggaatgatc       660
     ttccccgtgc ggcaccgccc ggtccgcggc aagaacggct tccgccgcca cccgatgcgc       720
     cacggcacca acgccgtcga gaccggacac cgcaacaccc tcggcatcat cttccacaac       780
     gcccgctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page