(data stored in ACNUC7421 zone)

EMBL: CP002047.PE445

CP002047.PE445       Location/Qualifiers
FT   CDS_pept        521292..522023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00445"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03566"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN8"
FT                   /protein_id="ADI03566.1"
FT                   /translation="MSQTPHPAGPVVDSIAQCDWAALTDELGEYGSALTGRLLTAAECR
FT                   EIAALYHEPGHFRTTVDMARHRFGSGQYRYFTHDLPKVVRELREAFYPRLLPIARDWAA
FT                   KLGRPAPWPDTLQEWIAMCHEAGQSKSAQILLRYGPGDWNALHRDVFGEMVFPLQVVIG
FT                   LDAPGSDFTGGEFLMTEQRPRAQSRGSSTTLFQGHGLVFTTRDRPVATKRGWANGPMRH
FT                   GVSTVRSGRRHTLGLVFHDAA"
     atgagccaga ccccccaccc cgcgggcccg gtcgtcgaca gcatcgccca gtgcgactgg        60
     gcggccctga ccgacgagtt gggcgagtac ggcagcgccc tgaccggccg gctgctcact       120
     gccgccgagt gccgcgagat cgccgcgctg taccacgagc ccggccactt ccgtacgacc       180
     gtcgacatgg cccgtcatcg cttcggctcc ggccagtacc gctacttcac ccacgacctg       240
     cccaaggtcg tacgggagct gcgcgaggcg ttctaccccc gcctcctccc catcgcccgc       300
     gactgggcgg ccaagctcgg ccgtcccgcc ccgtggccgg acactcttca ggagtggatt       360
     gccatgtgtc atgaggccgg gcagtccaag tccgcgcaga tcctgctgcg gtacggcccc       420
     ggtgactgga acgcgctgca ccgggacgtg ttcggggaga tggtcttccc gctccaggtg       480
     gtcatcggcc tggacgcgcc cggatcggat ttcaccggcg gggagtttct gatgaccgag       540
     cagcggcccc gcgcccagtc gagaggttcg tccaccaccc tgttccaggg acacgggctg       600
     gtcttcacca cccgcgaccg gccggtcgcc accaagcggg gctgggccaa cgggccgatg       660
     cggcacggtg tgagcaccgt ccgctccggc cgtcggcaca ccctcgggct cgtcttccac       720
     gacgcggcat ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page