(data stored in ACNUC7421 zone)

EMBL: CP002047.PE446

CP002047.PE446       Location/Qualifiers
FT   CDS_pept        522400..523440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00446"
FT                   /product="aminotransferase"
FT                   /note="COG1168 Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03567"
FT                   /db_xref="GOA:D7BYN9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN9"
FT                   /protein_id="ADI03567.1"
FT                   /translation="MDVPLAEPVAQAILDTVALGDTGYPTGRGYAEALAKFASERWDWD
FT                   GLTLERTAIVPDVMLGIVEMLKLVSGPGDPVIVNSPVYPPFYQLLENLGRPIIEAPLGA
FT                   DDRLDPAVLQGAFEHAREDGGRPVYLLCSPHNPTGTVHTADELADVAALARTGGVRVVV
FT                   DEIHAPIVAAGAIFVPYLSVPGSESGLSLMSASKAWNLAGLKAALAIAGPDAADDLDRL
FT                   PEAIGHPSHVGIIAHTAALRDGGDWLDSLLAGVDDNRRLLAHLLAEHLPAVRYAPGQAT
FT                   YLAWLDCRGLGLDDDPAAVFLERGRVALSSGIPFGTGGAGFVRLNLATSPTLLTEAVRR
FT                   MAAALD"
     atggatgttc ccctggccga gcccgtcgcc caggcgatcc tggacacggt ggcgctgggc        60
     gataccggct acccgaccgg gagggggtac gccgaggcgc tggccaagtt cgcgagcgag       120
     cgatgggact gggacgggct cacgctggag cgtacggcca tcgttccgga cgtgatgctg       180
     ggcatcgtcg agatgctgaa actggtgtca ggaccgggtg atccggtgat cgtcaactcc       240
     ccggtgtacc caccgttcta ccaactcctc gagaacctgg gccggcccat catcgaggct       300
     ccgctcggtg cggacgaccg gctcgaccca gccgtactgc agggtgcctt cgagcacgcc       360
     cgcgaggacg gaggccgacc tgtgtatctg ctctgcagcc cgcacaatcc gaccggtacg       420
     gtgcacaccg ccgacgagtt ggcggatgtg gcggcgctgg cgcggacggg tggcgtacgg       480
     gtcgtcgtcg acgagataca cgccccgatc gtggcggcgg gcgcgatatt cgtcccgtac       540
     ctgagcgtgc ccggctcgga gagcgggctg tcgctgatgt cggcgtccaa ggcgtggaac       600
     ctggccgggc tcaaggccgc cctggccatc gccggccccg atgcggccga cgatctcgat       660
     cgccttcccg aagcgattgg tcaccccagc catgtcggga tcatcgcgca caccgccgca       720
     ctgcgggacg gtggcgactg gctcgactcc ctgctcgccg gcgtcgacga caaccgccgg       780
     ctgctggccc acctgctggc cgaacatctg cccgccgtgc gctatgcccc gggccaggcc       840
     acctacctgg cctggctgga ctgccggggc ctgggcctgg acgacgaccc ggccgccgtg       900
     ttcctggagc gcggccgggt cgccctgagc tccggcatcc ccttcggaac cggcggcgcc       960
     ggcttcgtcc ggctgaatct ggccacctca cccacgctgc tcaccgaggc ggtgcggcgg      1020
     atggccgccg cgctcgactg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page