(data stored in ACNUC7421 zone)

EMBL: CP002047.PE447

CP002047.PE447       Location/Qualifiers
FT   CDS_pept        complement(523499..524101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00447"
FT                   /product="hypothetical protein"
FT                   /note="COG2176 DNA polymerase III, alpha subunit
FT                   (gram-positive type)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03568"
FT                   /db_xref="GOA:D7BYP0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP0"
FT                   /protein_id="ADI03568.1"
FT                   /translation="MSTFVVFDLEFTTWQGALEQDWGAPGQLREIVQIGALRLREDFSV
FT                   VEEYEALVRPVVNPQLSSYFAELTGIDQETVDREGASAAEALGDFLGFCQGQSVLSYGN
FT                   DMVVLGENVGWARARGENVKNGFLGAYFLNIRSWLNTVAPETENVNVGRLWQVLDLPKP
FT                   AEGKEHSALFDCYSFAAAIKHLCGTGAALPEGCMRCP"
     gtgtccacgt ttgttgtgtt cgaccttgaa ttcacgacat ggcagggggc gcttgagcag        60
     gactggggag cgccgggaca gcttcgtgag attgtgcaga tcggtgcgtt gcgcctgcgt       120
     gaggactttt ccgtcgtcga ggagtacgag gcactggtgc gacctgtggt caatccgcag       180
     ctgtcgtcct actttgccga gttgaccgga atcgaccagg agacggtgga ccgggaaggt       240
     gcttccgcgg cggaagcact tggtgacttc ctagggtttt gccaggggca gtcggtgctt       300
     tcctacggta acgacatggt cgttctcggg gagaatgtgg gctgggcacg agcccgaggg       360
     gaaaacgtca agaacgggtt cctcggtgcg tatttcctga atatccgatc ctggctgaac       420
     accgtcgcgc cggagacgga aaacgtcaac gtcggccgcc tgtggcaggt gctcgacctt       480
     cccaagcccg cggaagggaa ggagcattca gcgcttttcg actgctattc cttcgccgcg       540
     gccatcaagc acctgtgcgg caccggggca gcattgcccg agggctgtat gcggtgtccc       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page