(data stored in ACNUC7421 zone)

EMBL: CP002047.PE448

CP002047.PE448       Location/Qualifiers
FT   CDS_pept        complement(524300..524893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03569"
FT                   /db_xref="GOA:D7BYP1"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP1"
FT                   /protein_id="ADI03569.1"
FT                   /translation="MPMNTQPLGPGSVVSPRVLASVSGPSVAVPAPDRLVHLQFRRFAG
FT                   CPVCNLHLRSVVRRHGEIEAAGVREVVVFHSPAEELLEHTADLPFAVIADPDKRLYAEF
FT                   GVESAPRSLLSPRAWGPILRAILRSTWAILRRRERGPAGRPHGGRLGLPADFLIATDGR
FT                   VVAAKYGEHVYDQWSVDELLELSGRAPRPNLTTR"
     atgcccatga acacacagcc gttggggcct ggctctgtcg tcagcccccg cgtcctcgcc        60
     tccgtctccg gtccgtcggt cgccgtcccc gcccccgacc ggctggtcca cctgcagttc       120
     cggcgcttcg ccggctgtcc cgtctgcaat ctgcatctgc gctccgtggt acggcggcac       180
     ggtgagatcg aggcggccgg cgttcgcgag gtcgtggtct tccactcgcc cgccgaggaa       240
     ctgctggaac acacggccga cctgccgttc gccgtcatcg ccgatcccga caaacggctg       300
     tacgccgagt tcggcgtgga gtcggcgccc cgctcgctgc tgagcccccg cgcctggggg       360
     ccgatcctcc gggcgatctt gcgcagcacg tgggcgattc tccgcaggcg ggagcgcgga       420
     ccggcgggca ggccgcacgg cggccgactc ggccttcccg ccgacttcct gatcgcgacc       480
     gatggccgcg tcgtcgccgc aaagtacggc gagcatgtct acgaccagtg gtcggtcgat       540
     gagctgctgg agttgtcggg ccgcgcacca cgaccgaatc tcacgacccg atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page