(data stored in ACNUC7421 zone)

EMBL: CP002047.PE45

CP002047.PE45        Location/Qualifiers
FT   CDS_pept        complement(42319..42618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00045"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="COG1062 Zn-dependent alcohol dehydrogenases, class
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03166"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY9"
FT                   /protein_id="ADI03166.1"
FT                   /translation="MGDAVPCRDIPRFLDLWRAGQMPVERMHTGILPLTGISTAMEELA
FT                   SGRAIRQVIDTSGMLDVRPVDRGSGCARWPKGACRRHVATTKTLSCVVRRTRRL"
     atgggcgacg cggtaccgtg ccgcgacatt ccccggttcc tggacctgtg gcgggcgggc        60
     cagatgccgg tggagcggat gcacaccggc atcctgccgc tgaccggcat cagcacggcg       120
     atggaggagc tggcctcggg ccgggcgatc cgtcaggtca ttgacacatc gggaatgctg       180
     gacgtccgac cggtggaccg aggctcaggg tgcgcgaggt ggccgaaagg ggcatgccgg       240
     agacacgttg ccactaccaa gaccctgtcc tgtgtggtga ggcggacgag gcgtttgtag       300
//

If you have problems or comments...

PBIL Back to PBIL home page