(data stored in ACNUC7421 zone)

EMBL: CP002047.PE457

CP002047.PE457       Location/Qualifiers
FT   CDS_pept        complement(532901..533365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03578"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7C087"
FT                   /protein_id="ADI03578.1"
FT                   /translation="MIPVTVSIDVPQTPEQVYDFLDVMAHHERFTNHYLTDYRYSGPDR
FT                   GIGSCATVTVTLGGTKTDVAIEVVEAEAPRRIVERNVSAAGRRVAHGTYTIEPLPTGGS
FT                   HISFTYAWERAPLADRLLSPVVRPTMRRANRTVMQRLADELARHVSTADS"
     atgatccccg tcaccgtgtc gatcgacgta cctcagacac ccgagcaggt ctacgacttc        60
     ctcgatgtca tggcccacca cgagcgattc accaaccact acctgaccga ctaccgctac       120
     agcggccccg accgcggcat cggatcgtgc gccacggtca ccgtgacgct gggcggcacg       180
     aagaccgacg tcgccatcga ggtcgtcgag gccgaagcgc cgcgccgcat cgtcgaacgc       240
     aacgtcagcg cggccggccg acgcgtggcc cacggcacct acaccatcga accgctgcca       300
     accggcggca gccacatctc gttcacctac gcctgggaac gtgcccctct cgccgaccgg       360
     ctgctgtccc cggtcgtacg gcccacgatg cggcgcgcca accgtacggt catgcaacga       420
     ctggccgacg agctggcccg ccacgtgtcc actgccgact cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page