(data stored in ACNUC7421 zone)

EMBL: CP002047.PE462

CP002047.PE462       Location/Qualifiers
FT   CDS_pept        537570..538280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03583"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7C092"
FT                   /protein_id="ADI03583.1"
FT                   /translation="MTSMDDILREIADLREVMTNRFRQVEALTNLYAIIPVKHAMPQPT
FT                   KWTASPDLLLFLISHIQERRPVSILDIGSGATTVWMANALRHFEIPGKIISIDHDKSFG
FT                   AVTAATLTQQGLDTYADVRIAPLVEVDIKGERRHWYDPTQLEDVENCDMAVIDGPPGFT
FT                   HPLSRYPALPMLESKLSSDARIFLDDASRPDEREIVERWCREYPDWSSDFIDHEKGTAV
FT                   LARRTVIADEYPAE"
     atgacgtcga tggatgacat cctgagggaa atcgccgacc ttcgggaggt tatgacgaac        60
     cgtttccggc aggtcgaggc cctgacgaat ctctacgcaa tcattcccgt caaacacgca       120
     atgccccaac ccacaaagtg gacggcctca cccgacctcc tactattcct gatctcacac       180
     atccaggagc gacgtccggt ttccatcctg gacataggaa gcggcgccac aacggtctgg       240
     atggcaaacg cgcttcgcca tttcgaaatc cccgggaaga tcatctcaat cgaccatgac       300
     aaaagcttcg gtgccgtgac agccgccaca ttgacccagc aagggctgga cacatatgcg       360
     gacgtgcgta tcgccccact ggtcgaggtg gacatcaagg gagagcgacg gcactggtac       420
     gacccgacgc agctcgagga cgtcgagaac tgcgatatgg cggtgatcga cgggcctcca       480
     ggattcacgc atccactttc aaggtacccg gcactcccca tgcttgaatc gaagctgagc       540
     agcgatgcga ggatatttct ggacgacgcg agtcgtcccg acgagcggga gatagtcgag       600
     cgctggtgcc gcgagtatcc ggactggtcc tccgatttca ttgatcacga aaaggggacg       660
     gctgttctgg ctcggcgcac ggtgattgcc gatgaatacc cggcggagtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page