(data stored in ACNUC7421 zone)

EMBL: CP002047.PE464

CP002047.PE464       Location/Qualifiers
FT   CDS_pept        complement(539909..541300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00464"
FT                   /product="hypothetical protein"
FT                   /note="COG5383 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03585"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:D7C094"
FT                   /protein_id="ADI03585.1"
FT                   /translation="MITQWQLRAAFAARLSEMYGQEVPAYTTLVDVSREVNEDVLRAQG
FT                   ADAERLGSISRVTAERHGAIRVGTPKELRQVARIFAALGMHPVGFYDLREAAASAVPVI
FT                   STAFRPVDGEELARNPFRVFTSMLTPADPRFFDADLRSRLEAFLADRELFPAELLALAD
FT                   RATAERELPEADAERFLRLAVHAFELSPEPVDQAWYQTLERISAVAADIGGVRSTHINH
FT                   LTPRVLDIDELYRRMTERGIEMIDTIQGPPKWQGPDVLLRQTSFRALAEPRAMRTPDGS
FT                   VVSGALRVRFGEVEARGIALTRKGRALYDELLGHIDEQVSQNAADARGDIARAVWERHL
FT                   PGSERELAAAGLAYFTYRLDPDRPRDGNRPPTSVSELVRQGWVSAEPVVYEDFLPRSAA
FT                   GIFQSNLSGEGIRNNEREGTAYDAAWLSGAIGHDVLDPFALYEQQQNRSLAQVAHELDL
FT                   TGALG"
     atgatcactc agtggcagct gcgggccgca ttcgcggcgc ggctgtcgga gatgtacggg        60
     caggaggttc ccgcctacac cacgctcgtg gacgtttcgc gcgaggtcaa cgaggacgtc       120
     ctgcgcgcac agggagccga cgcggaacgc ctcgggtcca tcagccgggt gaccgccgag       180
     cggcacggag ccatccgcgt cggcacaccg aaggaactgc ggcaggtcgc ccgcatcttc       240
     gcggccctgg gcatgcaccc ggtcggcttc tacgatctgc gggaggccgc cgccagcgcc       300
     gtccccgtca tctccaccgc cttccggccg gtcgacggcg aggaactggc ccgcaacccc       360
     ttccgggtgt tcacctccat gctcaccccc gccgaccccc gcttcttcga cgcagacctg       420
     cgctcacgcc tggaggcctt cctcgcggac cgcgaactct tccccgccga actgctcgca       480
     ctggccgacc gcgccacggc ggagcgggag ctgcccgagg cggacgccga gcgctttctg       540
     cgactcgccg tgcacgcctt cgagctgtcg cccgagcccg tcgaccaggc gtggtaccag       600
     actctggagc ggatctccgc cgtcgccgcg gacatcggcg gcgtccgcag cacccacatc       660
     aaccacctca ccccgcgcgt cctggacatc gacgagctgt accggcggat gaccgagcgc       720
     ggcatcgaga tgatcgacac catccagggc ccgccgaagt ggcagggccc cgacgtcctg       780
     ctgcggcaga cctccttccg ggcgctggcc gaaccccgtg ccatgcgcac cccggacggc       840
     agcgtcgtca gtggcgccct acgagtccgc ttcggcgagg tcgaggcccg cggcatcgcc       900
     ctcacccgca agggccgcgc cctctacgac gaactcctcg gccacatcga tgagcaggtg       960
     tcccagaacg ctgctgacgc ccggggcgat atcgcgcgcg ccgtgtggga gcggcacctg      1020
     cccggcagcg aacgggaact cgccgccgcg gggctggcct acttcaccta ccggctcgac      1080
     ccggaccggc cgcgcgacgg caaccggccc cccaccagcg tcagcgaact ggtgcggcag      1140
     ggctgggtga gcgctgagcc cgtcgtctac gaggactttc tgccccgctc cgccgccggc      1200
     atcttccagt ccaacctcag cggcgagggc atccgcaaca acgagcgcga aggcaccgcc      1260
     tacgacgccg cctggctctc cggcgccatc ggccacgacg tgctggaccc cttcgccctc      1320
     tacgagcagc agcagaaccg ctccctcgca caggtcgccc acgagctcga cctcaccggc      1380
     gccctcggct ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page